Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NPPB, Human

NPPB proteins are members of the natriuretic peptide family and are key regulators of cardiovascular homeostasis. As a hormone, NPPB is produced and released primarily by ventricular myocytes in response to increases in pressure and volume. NPPB Protein, Human is the recombinant human-derived BNP protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

NPPB Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/bnp-protein-human.html

Purity

97.0

Smiles

SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH

Molecular Formula

4879 (Gene_ID) P16860 (S103-H134) (Accession)

Molecular Weight

Approximately 3.5 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Zc2hc1c Pre-designed siRNA Set A
SI216187A 1 Each

Rat Zc2hc1c Pre-designed siRNA Set A

Sign In for Pricing
View Details
GABA Receptor B R2, NT (Gamma-aminobutyric Acid Receptor Type B) (FITC)
G1015-55-FITC 100 µL

GABA Receptor B R2, NT (Gamma-aminobutyric Acid Receptor Type B) (FITC)

Sign In for Pricing
View Details
TRAF4 Human Over-expression Lysate
orb1366298 20 µg

TRAF4 Human Over-expression Lysate

Sign In for Pricing
View Details
VDB Protein, Mouse, Recombinant (E. coli, His)
TMPH-02972-01 5 µg

VDB Protein, Mouse, Recombinant (E. coli, His)

Sign In for Pricing
View Details
VDB Protein, Mouse, Recombinant (E. coli, His)
TMPH-02972-02 10 µg

VDB Protein, Mouse, Recombinant (E. coli, His)

Sign In for Pricing
View Details
VDB Protein, Mouse, Recombinant (E. coli, His)
TMPH-02972-03 20 µg

VDB Protein, Mouse, Recombinant (E. coli, His)

Sign In for Pricing
View Details