NPPB, Human
NPPB proteins are members of the natriuretic peptide family and are key regulators of cardiovascular homeostasis. As a hormone, NPPB is produced and released primarily by ventricular myocytes in response to increases in pressure and volume. NPPB Protein, Human is the recombinant human-derived BNP protein, expressed by E. coli , with tag free.
Product Specifications
Product Name Alternative
NPPB Protein, Human, Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/bnp-protein-human.html
Purity
97.0
Smiles
SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH
Molecular Formula
4879 (Gene_ID) P16860 (S103-H134) (Accession)
Molecular Weight
Approximately 3.5 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
RPC29456-01 20 µg
Recombinant Human Acetylcholine receptor subunit gamma (CHRNG), partial
Sign In for Pricing
View Details RPC29456-02 100 µg
Recombinant Human Acetylcholine receptor subunit gamma (CHRNG), partial
Sign In for Pricing
View Details RPC29456-03 1 mg
Recombinant Human Acetylcholine receptor subunit gamma (CHRNG), partial
Sign In for Pricing
View Details