Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRNP/CD230, Human (HEK293, hFc)

Although its primary function is unknown, the PRNP/CD230 protein has been implicated in multiple neuronal processes, including neuronal development, synaptic plasticity, and myelin homeostasis. PRNP acts as an agonist of the ADGRG6 receptor and promotes the maintenance of myelin. PRNP/CD230 Protein, Human (HEK293, Fc) is the recombinant human-derived PRNP/CD230 protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

PRNP/CD230 Protein, Human (HEK293, hFc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/prnp-cd230-protein-human-hek293-hfc.html

Purity

95.0

Smiles

KKRPKPGGWNTGGSRYPGQGSPGGNRYPPQGGGGWGQPHGGGWGQPHGGGWGQPHGGGWGQPHGGGWGQGGGTHSQWNKPSKPKTNMKHMAGAAAAGAVVGGLGGYMLGSAMSRPIIHFGSDYEDRYYRENMHRYPNQVYYRPMDEYSNQNNFVHDCVNITIKQHTVTTTTKGENFTETDVKMMERVVEQMCITQYERESQAYYQRG

Molecular Formula

5621 (Gene_ID) P04156 (K23-G229) (Accession)

Molecular Weight

Approximately 58-70 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DUS1L Protein Vector (Mouse) (pPB-N-His)
PV173655 500 ng

DUS1L Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
PF4 Rabbit Polyclonal Antibody
orb371746 100 µg

PF4 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Mouse Zeb2 Pre-designed siRNA Set A
SI116324A 1 Each

Mouse Zeb2 Pre-designed siRNA Set A

Sign In for Pricing
View Details
t-Boc-N-amido-PEG3-acid
572099 500.0mg

t-Boc-N-amido-PEG3-acid

Sign In for Pricing
View Details
GALNT7 Rabbit Polyclonal Antibody (Biotin)
orb2083459 100 µL

GALNT7 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
Ethyl (1R,2R) -2- (bromomethyl) cyclopropane-1-carboxylate
OR1070311-01 25 mg

Ethyl (1R,2R) -2- (bromomethyl) cyclopropane-1-carboxylate

Sign In for Pricing
View Details