Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Growth/differentiation factor 5 (GDF5)

Product Specifications

Product Name Alternative

GDF-5; Bone morphogenetic protein 14; BMP-14; Cartilage-derived morphogenetic protein 1; CDMP-1; Lipopolysaccharide-associated protein 4; LAP-4; LPS-associated protein 4; Radotermin

Abbreviation

Recombinant Human GDF5 protein

Gene Name

GDF5

UniProt

P43026

Expression Region

382-501aa

Organism

Homo sapiens (Human)

Target Sequence

APLATRQGKRPSKNLKARCSRKALHVNFKDMGWDDWIIAPLEYEAFHCEGLCEFPLRSHLEPTNHAVIQTLMNSMDPESTPPTCCVPTRLSPISILFIDSANNVVYKQYEDMVVESCGCR

Tag

C-terminal 6xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Cardiovascular

Relevance

Growth factor involved in bone and cartilage formation. During cartilage development regulates differentiation of chondrogenic tissue through two pathways. Firstly, positively regulates differentiation of chondrogenic tissue through its binding of high affinity with BMPR1B and of less affinity with BMPR1A, leading to induction of SMAD1-SMAD5-SMAD8 complex phosphorylation and then SMAD protein signaling transduction. Secondly, negatively regulates chondrogenic differentiation through its interaction with NOG. Required to prevent excessive muscle loss upon denervation. This function requires SMAD4 and is mediated by phosphorylated SMAD1/5/8. Binds bacterial lipopolysaccharide (LPS) and mediates LPS-induced inflammatory response, including TNF secretion by monocytes.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

20.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human DNAJC9 activation kit by CRISPRa
GA108148 1 Kit

Human DNAJC9 activation kit by CRISPRa

Sign In for Pricing
View Details
NKX2.8 (NKX28/2547), CF740 conjugate, 0.1mg/mL
BNC742547-100 1x 100 µL

NKX2.8 (NKX28/2547), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
p53 (TP53) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1F4]
TA502802BM 100 µL

p53 (TP53) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1F4]

Sign In for Pricing
View Details
CD79b (B-Cell Marker) (IGB/1844), 0.2mg/mL
BNUB1844-100 1x 100 µL

CD79b (B-Cell Marker) (IGB/1844), 0.2mg/mL

Sign In for Pricing
View Details
(R)-Butyryl Carnitine Chloride
TRC-B802700-250MG 250 mg

(R)-Butyryl Carnitine Chloride

Sign In for Pricing
View Details
2'-Bromoacetanilide
TRC-B679010-1G 1 g

2'-Bromoacetanilide

Sign In for Pricing
View Details