Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Gag-Pol polyprotein, HIV (440a.a, His)

The Gag-Pol polyprotein plays a central role in virion assembly, cooperating with Gag to bind to the plasma membrane, promote protein-protein interactions, recruit viral Env proteins, and package genomic RNA through direct interaction with the RNA packaging sequence (Psi) . Gag-Pol polyprotein, HIV (440a.a, His) is the recombinant Virus-derived Gag-Pol polyprotein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Gag-Pol polyprotein, HIV (440a.a, His), Virus, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gag-pol-polyprotein-hiv-440a-a-his.html

Purity

93.50

Smiles

PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETF

Molecular Formula

155348 (Gene_ID) P04585-1 (P588-F1027) (Accession)

Molecular Weight

Approximately 54 kDa.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Rabbit Polyclonal MANBA Antibody [Alexa Fluor 750]
NBP2-99160AF750 0.1 mL

Rabbit Polyclonal MANBA Antibody [Alexa Fluor 750]

Ask
View Details
CCM2 (NM_001167935) Human Over-expression Lysate
LH00505V 100 µg

CCM2 (NM_001167935) Human Over-expression Lysate

Ask
View Details
Hexdc (NM_001001333) Mouse Tagged ORF Clone
MR207466 10 µg

Hexdc (NM_001001333) Mouse Tagged ORF Clone

Ask
View Details
SPINK8-set siRNA/shRNA/RNAi Lentivector (Human)
45339091 4x 500 ng

SPINK8-set siRNA/shRNA/RNAi Lentivector (Human)

Ask
View Details
TP53BP2 (NM_005426) Human Tagged ORF Clone Lentiviral Particle
RC208939L3V 200 µL

TP53BP2 (NM_005426) Human Tagged ORF Clone Lentiviral Particle

Ask
View Details
GFRA1 (GDNF Family Receptor alpha-1, GDNF Receptor alpha-1, GDNFR-alpha-1, GFR-alpha-1, RET Ligand 1, TGF-beta-related Neurotrophic Factor Receptor 1, GDNFRA, RETL1, TRNR1) (MaxLight 490)
127281-ML490 100 µL

GFRA1 (GDNF Family Receptor alpha-1, GDNF Receptor alpha-1, GDNFR-alpha-1, GFR-alpha-1, RET Ligand 1, TGF-beta-related Neurotrophic Factor Receptor 1, GDNFRA, RETL1, TRNR1) (MaxLight 490)

Ask
View Details