Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Gag-Pol polyprotein, HIV (440a.a, His)

The Gag-Pol polyprotein plays a central role in virion assembly, cooperating with Gag to bind to the plasma membrane, promote protein-protein interactions, recruit viral Env proteins, and package genomic RNA through direct interaction with the RNA packaging sequence (Psi) . Gag-Pol polyprotein, HIV (440a.a, His) is the recombinant Virus-derived Gag-Pol polyprotein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Gag-Pol polyprotein, HIV (440a.a, His), Virus, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gag-pol-polyprotein-hiv-440a-a-his.html

Purity

93.50

Smiles

PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETF

Molecular Formula

155348 (Gene_ID) P04585-1 (P588-F1027) (Accession)

Molecular Weight

Approximately 54 kDa.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal TICRR Antibody [Alexa Fluor 594]
NBP2-41283AF594 0.1 mL

Rabbit Polyclonal TICRR Antibody [Alexa Fluor 594]

Sign In for Pricing
View Details
ACBD4 cDNA Clone
MBS1274939-01 0.01 mg Plasmid + 0.2 mL Glycerol-Stock

ACBD4 cDNA Clone

Sign In for Pricing
View Details
ACBD4 cDNA Clone
MBS1274939-02 5x 0.01 mg Plasmid + 5x 0.2 mL Glycerol-Stock

ACBD4 cDNA Clone

Sign In for Pricing
View Details
PHB2 sgRNA CRISPR Lentivector set (Human)
K1637601 3x 1.0 µg

PHB2 sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
Recombinant HPV-16 E6 [His] Protein
VAng-Wyb3040-1mg 1 mg

Recombinant HPV-16 E6 [His] Protein

Sign In for Pricing
View Details
LUCA15 Polyclonal Antibody, PE-Cy5.5 Conjugated
bs-6090R-PE-Cy5.5 100 µL

LUCA15 Polyclonal Antibody, PE-Cy5.5 Conjugated

Sign In for Pricing
View Details