S100P, Human (His)
The S100P protein is a multifunctional calcium sensor that actively contributes to cellular calcium signaling. It interacts calcium-dependently with proteins such as EZR and PPP5C, indirectly affecting processes such as microvilli formation. S100P Protein, Human (His) is the recombinant human-derived S100P protein, expressed by E. coli , with N-6*His labeled tag.
Product Specifications
Product Name Alternative
S100P Protein, Human (His), Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/s100p-protein-human-n-his.html
Purity
98.0
Smiles
TELETAMGMIIDVFSRYSGSEGSTQTLTKGELKVLMEKELPGFLQSGKDKDAVDKLLKDLDANGDAQVDFSEFIVFVAAITSACHKYFEKAGLK
Molecular Formula
6286 (Gene_ID) P25815 (T2-K95) (Accession)
Molecular Weight
9-12 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
Explore Other Products
Browse additional items from our catalog
CD59 (16.3A5, 1F5, 1F5 Antigen, 20kD Homologous Restriction Factor, CD 59, CD59 Antigen, CD59 Antigen Complement Regulatory Protein, CD59 Antigen p18 20, CD59 Antigen p18-20 (Antigen Identified by Monoclonal Antibodies 16.3A5, EJ16, EJ30, EL32 and G344), CD59 Glycoprotein, CD59 Molecule, CD59 Molecule Complement Regulatory Protein, CD59_HUMAN, Cd59a, Complement Regulatory Protein, EJ16, EJ30, EL32, G344, HRF 20, HRF-20, HRF20, Human Leukocyte Antigen MIC11, Ly 6 Like Protein, Lymphocytic Antigen CD59/MEM43, MAC Inhibitory Protein, MAC IP, MAC-inhibitory Protein, MAC-IP, MACIF, MACIP, MEM43, MEM43 Antigen, Membrane Attack Complex (MAC) Inhibition Factor, Membrane Attack Complex Inhibition Factor, Membrane Inhibitor of Reactive Lysis, MIC11, MIN1, MIN2, MIN3, MIRL, MSK21, p18 20, Protectin, Surface Antigen Recognized by Monoclonal, 16.3A5, T Cell Activating Protein)