Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

S100P, Human (His)

The S100P protein is a multifunctional calcium sensor that actively contributes to cellular calcium signaling. It interacts calcium-dependently with proteins such as EZR and PPP5C, indirectly affecting processes such as microvilli formation. S100P Protein, Human (His) is the recombinant human-derived S100P protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

S100P Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/s100p-protein-human-n-his.html

Purity

98.0

Smiles

TELETAMGMIIDVFSRYSGSEGSTQTLTKGELKVLMEKELPGFLQSGKDKDAVDKLLKDLDANGDAQVDFSEFIVFVAAITSACHKYFEKAGLK

Molecular Formula

6286 (Gene_ID) P25815 (T2-K95) (Accession)

Molecular Weight

9-12 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Anti-ZNF14 antibody
SL18493R-01 50 µL

Rabbit Anti-ZNF14 antibody

Sign In for Pricing
View Details
Rabbit Anti-ZNF14 antibody
SL18493R-02 100 µL

Rabbit Anti-ZNF14 antibody

Sign In for Pricing
View Details
Adenosine A1-R Polyclonal Antibody
UB-GEN-12933 100 µL

Adenosine A1-R Polyclonal Antibody

Sign In for Pricing
View Details
Human OR6M1 qPCR Primer Pair
QH76133S 200 Tests

Human OR6M1 qPCR Primer Pair

Sign In for Pricing
View Details
FZD1 Human Monoclonal Antibody (APC)
orb2972493-01 50 Tests

FZD1 Human Monoclonal Antibody (APC)

Sign In for Pricing
View Details
FZD1 Human Monoclonal Antibody (APC)
orb2972493-02 100 Tests

FZD1 Human Monoclonal Antibody (APC)

Sign In for Pricing
View Details