Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

S100P, Human (His)

The S100P protein is a multifunctional calcium sensor that actively contributes to cellular calcium signaling. It interacts calcium-dependently with proteins such as EZR and PPP5C, indirectly affecting processes such as microvilli formation. S100P Protein, Human (His) is the recombinant human-derived S100P protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

S100P Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/s100p-protein-human-n-his.html

Purity

98.0

Smiles

TELETAMGMIIDVFSRYSGSEGSTQTLTKGELKVLMEKELPGFLQSGKDKDAVDKLLKDLDANGDAQVDFSEFIVFVAAITSACHKYFEKAGLK

Molecular Formula

6286 (Gene_ID) P25815 (T2-K95) (Accession)

Molecular Weight

9-12 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hyperoside
MBS577876 Inquire

Hyperoside

Sign In for Pricing
View Details
GDF1 Polyclonal Antibody
MBS2526908-01 0.02 mL

GDF1 Polyclonal Antibody

Sign In for Pricing
View Details
GDF1 Polyclonal Antibody
MBS2526908-02 0.06 mL

GDF1 Polyclonal Antibody

Sign In for Pricing
View Details
GDF1 Polyclonal Antibody
MBS2526908-03 0.12 mL

GDF1 Polyclonal Antibody

Sign In for Pricing
View Details
GDF1 Polyclonal Antibody
MBS2526908-04 0.2 mL

GDF1 Polyclonal Antibody

Sign In for Pricing
View Details
GDF1 Polyclonal Antibody
MBS2526908-05 5x 0.2 mL

GDF1 Polyclonal Antibody

Sign In for Pricing
View Details