Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

S100P, Human (His)

The S100P protein is a multifunctional calcium sensor that actively contributes to cellular calcium signaling. It interacts calcium-dependently with proteins such as EZR and PPP5C, indirectly affecting processes such as microvilli formation. S100P Protein, Human (His) is the recombinant human-derived S100P protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

S100P Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/s100p-protein-human-n-his.html

Purity

98.0

Smiles

TELETAMGMIIDVFSRYSGSEGSTQTLTKGELKVLMEKELPGFLQSGKDKDAVDKLLKDLDANGDAQVDFSEFIVFVAAITSACHKYFEKAGLK

Molecular Formula

6286 (Gene_ID) P25815 (T2-K95) (Accession)

Molecular Weight

9-12 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KCNT2 Protein Vector (Mouse) (pPB-C-His)
PV193858 500 ng

KCNT2 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
CDK9 Polyclonal Antibody
MBS127761-01 0.02 mL

CDK9 Polyclonal Antibody

Sign In for Pricing
View Details
CDK9 Polyclonal Antibody
MBS127761-02 0.1 mL

CDK9 Polyclonal Antibody

Sign In for Pricing
View Details
CDK9 Polyclonal Antibody
MBS127761-03 5x 0.1 mL

CDK9 Polyclonal Antibody

Sign In for Pricing
View Details
anti-β-catenin (C-term)
LF-PA0162 100 ul

anti-β-catenin (C-term)

Sign In for Pricing
View Details
Ox40 (6A371) PE
sc-71769 PE 200 µg/mL

Ox40 (6A371) PE

Sign In for Pricing
View Details