Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Tumor necrosis factor receptor superfamily member 4 (TNFRSF4), partial

Product Specifications

Product Name Alternative

(ACT35 antigen) (OX40L receptor) (TAX transcriptionally-activated glycoprotein 1 receptor) (CD antigen CD134)

Abbreviation

Recombinant Human TNFRSF4 protein, partial

Gene Name

TNFRSF4

UniProt

P43489

Expression Region

29-216aa

Organism

Homo sapiens (Human)

Target Sequence

LHCVGDTYPSNDRCCHECRPGNGMVSRCSRSQNTVCRPCGPGFYNDVVSSKPCKPCTWCNLRSGSERKQLCTATQDTVCRCRAGTQPLDSYKPGVDCAPCPPGHFSPGDNQACKPWTNCTLAGKHTLQPASNSSDAICEDRDPPATQPQETQGPPARPITVQPTEAWPRTSQGPSTRPVEVPGGRAVA

Tag

C-terminal hFc1-Myc-tagged

Type

In Stock Protein

Source

Mammalian cell

Field of Research

Immunology

Relevance

Receptor for TNFSF4/OX40L/GP34. Is a costimulatory molecule implicated in long-term T-cell immunity. ; (Microbial infection) Acts as a receptor for human herpesvirus 6B/HHV-6B.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

49.3 kDa

References & Citations

"The crystal structure of the costimulatory OX40-OX40L complex." Compaan D.M., Hymowitz S.G. Structure 14:1321-1330 (2006)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Metallothionein (MT, CES1, Metallothionein 1A, MT-1A, MT1A, MT1, Metallothionein 1S, MT1S, Metallothionein 2, MT-2, MT2, Metallothionein 2A, MT-2A, MT2A, Metallothionein IA, MT-IA, Metallothionein II, MT-II, MGC32848, MTC)
M3009-10-01 50 µg

Metallothionein (MT, CES1, Metallothionein 1A, MT-1A, MT1A, MT1, Metallothionein 1S, MT1S, Metallothionein 2, MT-2, MT2, Metallothionein 2A, MT-2A, MT2A, Metallothionein IA, MT-IA, Metallothionein II, MT-II, MGC32848, MTC)

Sign In for Pricing
View Details
Metallothionein (MT, CES1, Metallothionein 1A, MT-1A, MT1A, MT1, Metallothionein 1S, MT1S, Metallothionein 2, MT-2, MT2, Metallothionein 2A, MT-2A, MT2A, Metallothionein IA, MT-IA, Metallothionein II, MT-II, MGC32848, MTC)
M3009-10-02 200 µg

Metallothionein (MT, CES1, Metallothionein 1A, MT-1A, MT1A, MT1, Metallothionein 1S, MT1S, Metallothionein 2, MT-2, MT2, Metallothionein 2A, MT-2A, MT2A, Metallothionein IA, MT-IA, Metallothionein II, MT-II, MGC32848, MTC)

Sign In for Pricing
View Details
Rabbit Monoclonal TCR beta Antibody (H57-597) [Alexa Fluor 594] - Chimeric
NBP3-20118AF594 0.1 mL

Rabbit Monoclonal TCR beta Antibody (H57-597) [Alexa Fluor 594] - Chimeric

Sign In for Pricing
View Details
Human sP-selectin ELISA Kit
E110891 1 Each

Human sP-selectin ELISA Kit

Sign In for Pricing
View Details
C19orf51 (DNAAF3) Human shRNA Plasmid Kit (Locus ID 352909)
TR307816 1 Kit

C19orf51 (DNAAF3) Human shRNA Plasmid Kit (Locus ID 352909)

Sign In for Pricing
View Details
Recombinant Bovine Inositol 1,4,5-trisphosphate receptor type 1 (ITPR1) , partial
MBS7101623 Inquire

Recombinant Bovine Inositol 1,4,5-trisphosphate receptor type 1 (ITPR1) , partial

Sign In for Pricing
View Details