Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ESAM, Human (HEK293, His)

ESAM, short for Endothelial Cell Selective Adhesion Molecule, has the ability to induce aggregation, possibly through homophilic molecular interactions. It plays a role in molecular communication by binding to MAGI1, possibly forming complexes that contribute to intercellular signaling and adhesion processes. ESAM Protein, Human (HEK293, His) is the recombinant human-derived ESAM protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

ESAM Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/esam-protein-human-hek-293-his.html

Purity

95.0

Smiles

QLQLHLPANRLQAVEGGEVVLPAWYTLHGEVSSSQPWEVPFVMWFFKQKEKEDQVLSYINGVTTSKPGVSLVYSMPSRNLSLRLEGLQEKDSGPYSCSVNVQDKQGKSRGHSIKTLELNVLVPPAPPSCRLQGVPHVGANVTLSCQSPRSKPAVQYQWDRQLPSFQTFFAPALDVIRGSLSLTNLSSSMAGVYVCKAHNEVGTAQCNVTLEVSTGPGA

Molecular Formula

90952 (Gene_ID) Q96AP7-1 (Q30-A247) (Accession)

Molecular Weight

Approximately 36.55 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF740 conjugate, 0.1mg/mL
BNC741820-500 1x 500 µL

Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD106 / VCAM1 (B-K9), CF740 conjugate, 0.1mg/mL
BNC740304-100 1x 100 µL

CD106 / VCAM1 (B-K9), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45 / LCA (2B11 + PD7/26), CF640R conjugate, 0.1mg/mL
BNC400745-500 1x 500 µL

CD45 / LCA (2B11 + PD7/26), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P53 (PAb122), CF640R conjugate, 0.1mg/mL
BNC400338-500 1x 500 µL

P53 (PAb122), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 8 (KRT8/803), CF647 conjugate, 0.1mg/mL
BNC470803-100 1x 100 µL

Cytokeratin 8 (KRT8/803), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Von Willebrand Factor (VWF635), CF740 conjugate, 0.1mg/mL
BNC740635-100 1x 100 µL

Von Willebrand Factor (VWF635), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details