Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ESAM, Human (HEK293, His)

ESAM, short for Endothelial Cell Selective Adhesion Molecule, has the ability to induce aggregation, possibly through homophilic molecular interactions. It plays a role in molecular communication by binding to MAGI1, possibly forming complexes that contribute to intercellular signaling and adhesion processes. ESAM Protein, Human (HEK293, His) is the recombinant human-derived ESAM protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

ESAM Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/esam-protein-human-hek-293-his.html

Purity

95.0

Smiles

QLQLHLPANRLQAVEGGEVVLPAWYTLHGEVSSSQPWEVPFVMWFFKQKEKEDQVLSYINGVTTSKPGVSLVYSMPSRNLSLRLEGLQEKDSGPYSCSVNVQDKQGKSRGHSIKTLELNVLVPPAPPSCRLQGVPHVGANVTLSCQSPRSKPAVQYQWDRQLPSFQTFFAPALDVIRGSLSLTNLSSSMAGVYVCKAHNEVGTAQCNVTLEVSTGPGA

Molecular Formula

90952 (Gene_ID) Q96AP7-1 (Q30-A247) (Accession)

Molecular Weight

Approximately 36.55 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ethyl 2- (2,4-dichloro-5-fluorobenzoyl) -3- (dimethylamino) acrylate
PC1002121-01 250 mg

Ethyl 2- (2,4-dichloro-5-fluorobenzoyl) -3- (dimethylamino) acrylate

Sign In for Pricing
View Details
Ethyl 2- (2,4-dichloro-5-fluorobenzoyl) -3- (dimethylamino) acrylate
PC1002121-02 1 g

Ethyl 2- (2,4-dichloro-5-fluorobenzoyl) -3- (dimethylamino) acrylate

Sign In for Pricing
View Details
Ethyl 2- (2,4-dichloro-5-fluorobenzoyl) -3- (dimethylamino) acrylate
PC1002121-03 5 g

Ethyl 2- (2,4-dichloro-5-fluorobenzoyl) -3- (dimethylamino) acrylate

Sign In for Pricing
View Details
HNRNPUL2 (Center) Rabbit pAb
E2620811 100 µL

HNRNPUL2 (Center) Rabbit pAb

Sign In for Pricing
View Details
TUSC3 Antibody - N-terminal region : HRP (ARP74316_P050-HRP)
ARP74316_P050-HRP 100 µL

TUSC3 Antibody - N-terminal region : HRP (ARP74316_P050-HRP)

Sign In for Pricing
View Details
Anti-Mouse SEMA3A (KIAA4055), Rabbit Polyclonal
MKA4055 Inquire

Anti-Mouse SEMA3A (KIAA4055), Rabbit Polyclonal

Sign In for Pricing
View Details