Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DR6/TNFRSF21, Cynomolgus (HEK293, His)

Tnfrsf21 Protein, also known as death receptor 6 (DR6), CD358, or BM-018, is highly expressed in differentiating neurons as well as in the adult brain, and is upregulated in injured neurons. DR6 negatively regulates neuron, axon, and oligodendrocyte survival, hinders axondendrocyte and oligodendrocyte regeneration and its inhibition has a neuro-protective effect in nerve injury. It activates nuclear factor kappa-B (NFkB) and mitogen-activated protein kinase 8 (MAPK8, also called c-Jun N-terminal kinase 1), and induces cell apoptosis by associating with TNFRSF1A-associated via death domain (TRADD), which is known to mediate signal transduction of tumor necrosis factor receptors. DR6/TNFRSF21 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived DR6/TNFRSF21 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

DR6/TNFRSF21 Protein, Cynomolgus (HEK293, His), Cynomolgus, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/dr6-tnfrsf21-protein-cynomolgus-hek293-his.html

Purity

96.00

Smiles

QPEQKASNLIGTYRHVDRATGQVLTCDKCPAGTYVSEHCTNTSLRVCSSCPVGTFTRHENGIEKCHDCSQPCPWPMIEKLPCAALTDRECTCPPGMFQSNATCAPHTVCPVGWGVRKKGTETEDVRCKQCARGTFSDVPSSVMKCKAYTDCLSQNLVVIKPGTKEADNVCGTLPSFSSSTSPSPGTAIFSRPEHMDSHEVPSSTYVPKGMNSTESNSSASVRPKVLSSIQEGTVPDNTSSARGKEDVNKTLPNLQVVNHQQGPHHRHILKLLPSMEATGGEKSSTPIKGPKRGHPRQNLHKHFDINEHL

Molecular Formula

101925746 (Gene_ID) XP_005552846 (Q42-L350) (Accession)

Molecular Weight

Approximately 55-75 kDa.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD31 / PECAM-1 (158-2B3), CF594 conjugate, 0.1mg/mL
BNC940352-100 1x 100 µL

CD31 / PECAM-1 (158-2B3), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD95 (B-R18), CF640R conjugate, 0.1mg/mL
BNC400305-100 1x 100 µL

CD95 (B-R18), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Pmel17 / gp100 / SILV (NKI-beteb), CF740 conjugate, 0.1mg/mL
BNC740226-100 1x 100 µL

Pmel17 / gp100 / SILV (NKI-beteb), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HCG-beta (HCGb/54), CF405S conjugate, 0.1mg/mL
BNC040054-100 1x 100 µL

HCG-beta (HCGb/54), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD79a (B-Cell Marker) (rIGA/764), CF740 conjugate, 0.1mg/mL
BNC741862-500 1x 500 µL

CD79a (B-Cell Marker) (rIGA/764), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
AFP (Alpha Fetoprotein) (MBS-12), CF647 conjugate, 0.1mg/mL
BNC470521-500 1x 500 µL

AFP (Alpha Fetoprotein) (MBS-12), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details