Angiopoietin-1, Human (HEK293, Fc)

DTVHNLVNLCTKEGVLLKGGKREEEKPFRDCADVYQAGFNKSGIYTIYINNMPEPKKVFCNMDVNGGGWTVIQHREDGSLDFQRGWKEYKMGFGNPSGEYWLGNEFIFAITSQRQYMLRIELMDWEGNRAYSQYDRFHIGNEKQNYRLYLKGHTGTAGKQSSLILHGADFSTKDADNDNCMCKCALMLTGGWWFDACGPSNLNGMFYTAGQNHGKLNGIKWHYFKGPSYSLRSTTMMIRPLDF

[1]Gou Young Koh, et al. Orchestral actions of angiopoietin-1 in vascular regeneration. Trends Mol Med. 2013 Jan;19 (1) :31-9.|[2]Nuri Oh, et al. A Designed Angiopoietin-1 Variant, Dimeric CMP-Ang1 Activates Tie2 and Stimulates Angiogenesis and Vascular Stabilization in N-glycan Dependent Manner.Sci Rep. 2015 Oct 19;5:15291.|[3]Suri C, et al. Increased vascularization in mice overexpressing angiopoietin-1. Science. 1998 Oct 16;282 (5388) :468-71.|[4]Koblizek TI, et al. Angiopoietin-1 induces sprouting angiogenesis in vitro. Curr Biol. 1998 Apr 23;8 (9) :529-32.|[5]Davis S, et al. Isolation of angiopoietin-1, a ligand for the TIE2 receptor, by secretion-trap expression cloning. Cell. 1996 Dec 27;87 (7) :1161-9.|[6]Rada M, et al. Angiopoietin-1 Upregulates Cancer Cell Motility in Colorectal Cancer Liver Metastases through Actin-Related Protein 2/3. Cancers (Basel) . 2022 May 21;14 (10) :2540. |[7]Ma D, et al. Intracellular angiopoietin-1 promotes TKI-resistance via activation of JAK/STAT5 pathway in chronic myeloid leukemia. Oncogene. 2023 Jan;42 (2) :124-137.