TFF1, Human (HEK293, His)
TFF1 protein functions as a mucous gel stabilizer, vital for fortifying the gastrointestinal mucosa against noxious agents. It contributes to the mucous layer's integrity, providing a crucial physical barrier for the gastrointestinal tract, safeguarding it from potential harm. TFF1's stabilizing role emphasizes its significance in preserving the mucosal barrier, essential for overall gastrointestinal health and protection. TFF1 Protein, Human (HEK293, His) is the recombinant human-derived TFF1 protein, expressed by HEK293 , with C-6*His labeled tag.
Product Specifications
Product Name Alternative
TFF1 Protein, Human (HEK293, His), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/tff1-protein-human-hek-293-his.html
Purity
97.30
Smiles
EAQTETCTVAPRERQNCGFPGVTPSQCANKGCCFDDTVRGVPWCFYPNTIDVPPEEECEF
Molecular Formula
7031 (Gene_ID) P04155 (E25-F84) (Accession)
Molecular Weight
Approximately 14 kDa, based on SDS-PAGE under reducing conditions.
Shipping Conditions
Dry ice.
Storage Conditions
Stored at -80°C for 1 year
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
Explore Other Products
Browse additional items from our catalog
ACTH (Adrenocorticotrophic Hormone) (AH26), CF405S conjugate, 0.1mg/mL
Thyroglobulin (Thyroidal Cell Marker) (TGB/1970R), CF568 conjugate, 0.1mg/mL
VEGF-A (VEGF/1063), CF740 conjugate, 0.1mg/mL
SOX9 / SRY-box 9 (PCRP-SOX9-1E5), CF405S conjugate, 0.1mg/mL
