Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-3, Mouse (HEK293, His)

IL-3 Protein, Mouse (HEK293, His) is a multilineage hematopoietic cytokine with promising effects on platelet and neutrophil counts and special usefulness in patients with secondary hematopoietic failure.

Product Specifications

Product Name Alternative

IL-3 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-3-protein-mouse-hek293-his.html

Purity

96.00

Smiles

ASISGRDTHRLTRTLNCSSIVKEIIGKLPEPELKTDDEGPSLRNKSFRRVNLSKFVESQGEVDPEDRYVIKSNLQKLNCCLPTSANDSALPGVFIRDLDDFRKKLRFYMVHLNDLETVLTSRPPQPASGSVSPNRGTVEC

Molecular Formula

16187 (Gene_ID) P01586 (A27-C166) (Accession)

Molecular Weight

Approximately 25-30 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

References & Citations

[1]Huhn RD, et al. Recombinant human interleukin-3 (rhIL-3) enhances the mobilization of peripheral blood progenitor cells by recombinant human granulocyte colony-stimulating factor (rhG-CSF) in normal volunteers. Exp Hematol. 1996 Jun;24 (7) :839-47.|[2]Dagar VK, et al. Combined effect of gene dosage and process optimization strategies on high-level production of recombinant human interleukin-3 (hIL-3) in Pichia pastoris fed-batch culture. Int J Biol Macromol. 2018 Mar;108:999-1009.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Guinea Pig Parathyroid hormone ELISA Kit
MBS722197-01 48 Well

Guinea Pig Parathyroid hormone ELISA Kit

Ask
View Details
Guinea Pig Parathyroid hormone ELISA Kit
MBS722197-02 96 Well

Guinea Pig Parathyroid hormone ELISA Kit

Ask
View Details
Guinea Pig Parathyroid hormone ELISA Kit
MBS722197-03 5x 96 Well

Guinea Pig Parathyroid hormone ELISA Kit

Ask
View Details
Guinea Pig Parathyroid hormone ELISA Kit
MBS722197-04 10x 96 Well

Guinea Pig Parathyroid hormone ELISA Kit

Ask
View Details
Phospho-Estrogen Receptor alpha (Ser118) Recombinant Antibody, AbBy Fluor™ 680 Conjugated
bsm-52154R-BF680-01 20 µL

Phospho-Estrogen Receptor alpha (Ser118) Recombinant Antibody, AbBy Fluor™ 680 Conjugated

Ask
View Details
Phospho-Estrogen Receptor alpha (Ser118) Recombinant Antibody, AbBy Fluor™ 680 Conjugated
bsm-52154R-BF680-02 100 µL

Phospho-Estrogen Receptor alpha (Ser118) Recombinant Antibody, AbBy Fluor™ 680 Conjugated

Ask
View Details