Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-3, Mouse (HEK293, His)

IL-3 Protein, Mouse (HEK293, His) is a multilineage hematopoietic cytokine with promising effects on platelet and neutrophil counts and special usefulness in patients with secondary hematopoietic failure.

Product Specifications

Product Name Alternative

IL-3 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-3-protein-mouse-hek293-his.html

Purity

96.00

Smiles

ASISGRDTHRLTRTLNCSSIVKEIIGKLPEPELKTDDEGPSLRNKSFRRVNLSKFVESQGEVDPEDRYVIKSNLQKLNCCLPTSANDSALPGVFIRDLDDFRKKLRFYMVHLNDLETVLTSRPPQPASGSVSPNRGTVEC

Molecular Formula

16187 (Gene_ID) P01586 (A27-C166) (Accession)

Molecular Weight

Approximately 25-30 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

References & Citations

[1]Huhn RD, et al. Recombinant human interleukin-3 (rhIL-3) enhances the mobilization of peripheral blood progenitor cells by recombinant human granulocyte colony-stimulating factor (rhG-CSF) in normal volunteers. Exp Hematol. 1996 Jun;24 (7) :839-47.|[2]Dagar VK, et al. Combined effect of gene dosage and process optimization strategies on high-level production of recombinant human interleukin-3 (hIL-3) in Pichia pastoris fed-batch culture. Int J Biol Macromol. 2018 Mar;108:999-1009.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Open Bath, 17L, Polycarbonate, MX (Ambient +10° to 85°C), 240V, 50Hz
MX17P100-A12E 1 Each

Open Bath, 17L, Polycarbonate, MX (Ambient +10° to 85°C), 240V, 50Hz

Sign In for Pricing
View Details
(5β,6α) -6-Hydroxy-3-oxo-cholan-24-oic Acid
014258 5 mg

(5β,6α) -6-Hydroxy-3-oxo-cholan-24-oic Acid

Sign In for Pricing
View Details
Rat Secretogranin-2 (SCG2) ELISA Kit
RK14785 96 Tests

Rat Secretogranin-2 (SCG2) ELISA Kit

Sign In for Pricing
View Details
Goat Coiled-coil domain-containing protein 73 (CCDC73) ELISA Kit
MBS7228639-01 48 Well

Goat Coiled-coil domain-containing protein 73 (CCDC73) ELISA Kit

Sign In for Pricing
View Details
Goat Coiled-coil domain-containing protein 73 (CCDC73) ELISA Kit
MBS7228639-02 96 Well

Goat Coiled-coil domain-containing protein 73 (CCDC73) ELISA Kit

Sign In for Pricing
View Details
Goat Coiled-coil domain-containing protein 73 (CCDC73) ELISA Kit
MBS7228639-03 5x 96 Well

Goat Coiled-coil domain-containing protein 73 (CCDC73) ELISA Kit

Sign In for Pricing
View Details