Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-3, Mouse (HEK293, His)

IL-3 Protein, Mouse (HEK293, His) is a multilineage hematopoietic cytokine with promising effects on platelet and neutrophil counts and special usefulness in patients with secondary hematopoietic failure.

Product Specifications

Product Name Alternative

IL-3 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-3-protein-mouse-hek293-his.html

Purity

96.00

Smiles

ASISGRDTHRLTRTLNCSSIVKEIIGKLPEPELKTDDEGPSLRNKSFRRVNLSKFVESQGEVDPEDRYVIKSNLQKLNCCLPTSANDSALPGVFIRDLDDFRKKLRFYMVHLNDLETVLTSRPPQPASGSVSPNRGTVEC

Molecular Formula

16187 (Gene_ID) P01586 (A27-C166) (Accession)

Molecular Weight

Approximately 25-30 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

References & Citations

[1]Huhn RD, et al. Recombinant human interleukin-3 (rhIL-3) enhances the mobilization of peripheral blood progenitor cells by recombinant human granulocyte colony-stimulating factor (rhG-CSF) in normal volunteers. Exp Hematol. 1996 Jun;24 (7) :839-47.|[2]Dagar VK, et al. Combined effect of gene dosage and process optimization strategies on high-level production of recombinant human interleukin-3 (hIL-3) in Pichia pastoris fed-batch culture. Int J Biol Macromol. 2018 Mar;108:999-1009.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

SSTR2 Peptide
DF7206-BP 1 mg

SSTR2 Peptide

Ask
View Details
Anti-MAP7D1 Polyclonal Antibody
MF-0079786-01 50 µL

Anti-MAP7D1 Polyclonal Antibody

Ask
View Details
Anti-MAP7D1 Polyclonal Antibody
MF-0079786-02 100 µL

Anti-MAP7D1 Polyclonal Antibody

Ask
View Details
Anti-MAP7D1 Polyclonal Antibody
MF-0079786-03 200 µL

Anti-MAP7D1 Polyclonal Antibody

Ask
View Details
Protein Kinase C, zeta (Protein Kinase C zeta Type, PKCz, PRKCZ, nPKC zeta, nPKC-zeta, OTTHUMP00000044160, PKC2) (FITC) discontinued
P9103-40K-FITC 100 µL

Protein Kinase C, zeta (Protein Kinase C zeta Type, PKCz, PRKCZ, nPKC zeta, nPKC-zeta, OTTHUMP00000044160, PKC2) (FITC) discontinued

Ask
View Details
Mouse Monoclonal TRAF-1 Antibody (TRAF1/3298) [DyLight 550]
NBP2-79925R 0.1 mL

Mouse Monoclonal TRAF-1 Antibody (TRAF1/3298) [DyLight 550]

Ask
View Details