Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-3, Mouse (HEK293, His)

IL-3 Protein, Mouse (HEK293, His) is a multilineage hematopoietic cytokine with promising effects on platelet and neutrophil counts and special usefulness in patients with secondary hematopoietic failure.

Product Specifications

Product Name Alternative

IL-3 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-3-protein-mouse-hek293-his.html

Purity

96.00

Smiles

ASISGRDTHRLTRTLNCSSIVKEIIGKLPEPELKTDDEGPSLRNKSFRRVNLSKFVESQGEVDPEDRYVIKSNLQKLNCCLPTSANDSALPGVFIRDLDDFRKKLRFYMVHLNDLETVLTSRPPQPASGSVSPNRGTVEC

Molecular Formula

16187 (Gene_ID) P01586 (A27-C166) (Accession)

Molecular Weight

Approximately 25-30 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

References & Citations

[1]Huhn RD, et al. Recombinant human interleukin-3 (rhIL-3) enhances the mobilization of peripheral blood progenitor cells by recombinant human granulocyte colony-stimulating factor (rhG-CSF) in normal volunteers. Exp Hematol. 1996 Jun;24 (7) :839-47.|[2]Dagar VK, et al. Combined effect of gene dosage and process optimization strategies on high-level production of recombinant human interleukin-3 (hIL-3) in Pichia pastoris fed-batch culture. Int J Biol Macromol. 2018 Mar;108:999-1009.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Recombinant Lama glama Cytochrome b (MT-CYB), partial
MBS7077513 Inquire

Recombinant Lama glama Cytochrome b (MT-CYB), partial

Ask
View Details
CD11b (CD11 antigen-like family member B, CD11b/CD18, CD49d, Cell surface glycoprotein MAC-1 subunit alpha, Complement Component Receptor 3 Alpha, CR3 Alpha Chain (CR3A), Integrin alpha-M, Integrin beta 2 alpha subunit, ITGAM, Leukocyte adhesion receptor
MBS6122625-01 0.1 mL

CD11b (CD11 antigen-like family member B, CD11b/CD18, CD49d, Cell surface glycoprotein MAC-1 subunit alpha, Complement Component Receptor 3 Alpha, CR3 Alpha Chain (CR3A), Integrin alpha-M, Integrin beta 2 alpha subunit, ITGAM, Leukocyte adhesion receptor

Ask
View Details
CD11b (CD11 antigen-like family member B, CD11b/CD18, CD49d, Cell surface glycoprotein MAC-1 subunit alpha, Complement Component Receptor 3 Alpha, CR3 Alpha Chain (CR3A), Integrin alpha-M, Integrin beta 2 alpha subunit, ITGAM, Leukocyte adhesion receptor
MBS6122625-02 5x 0.1 mL

CD11b (CD11 antigen-like family member B, CD11b/CD18, CD49d, Cell surface glycoprotein MAC-1 subunit alpha, Complement Component Receptor 3 Alpha, CR3 Alpha Chain (CR3A), Integrin alpha-M, Integrin beta 2 alpha subunit, ITGAM, Leukocyte adhesion receptor

Ask
View Details
Ataxia Telangiectasia Mutated Phospho-Ser1981 (ATM pS1981) Antibody
abx325370-01 50 µg

Ataxia Telangiectasia Mutated Phospho-Ser1981 (ATM pS1981) Antibody

Ask
View Details
Ataxia Telangiectasia Mutated Phospho-Ser1981 (ATM pS1981) Antibody
abx325370-02 100 µg

Ataxia Telangiectasia Mutated Phospho-Ser1981 (ATM pS1981) Antibody

Ask
View Details
Mouse Chpf (NM_001001566) AAV Particle
MR216423A1V 250 µL

Mouse Chpf (NM_001001566) AAV Particle

Ask
View Details