Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-3, Mouse (HEK293, His)

IL-3 Protein, Mouse (HEK293, His) is a multilineage hematopoietic cytokine with promising effects on platelet and neutrophil counts and special usefulness in patients with secondary hematopoietic failure.

Product Specifications

Product Name Alternative

IL-3 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-3-protein-mouse-hek293-his.html

Purity

96.00

Smiles

ASISGRDTHRLTRTLNCSSIVKEIIGKLPEPELKTDDEGPSLRNKSFRRVNLSKFVESQGEVDPEDRYVIKSNLQKLNCCLPTSANDSALPGVFIRDLDDFRKKLRFYMVHLNDLETVLTSRPPQPASGSVSPNRGTVEC

Molecular Formula

16187 (Gene_ID) P01586 (A27-C166) (Accession)

Molecular Weight

Approximately 25-30 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

References & Citations

[1]Huhn RD, et al. Recombinant human interleukin-3 (rhIL-3) enhances the mobilization of peripheral blood progenitor cells by recombinant human granulocyte colony-stimulating factor (rhG-CSF) in normal volunteers. Exp Hematol. 1996 Jun;24 (7) :839-47.|[2]Dagar VK, et al. Combined effect of gene dosage and process optimization strategies on high-level production of recombinant human interleukin-3 (hIL-3) in Pichia pastoris fed-batch culture. Int J Biol Macromol. 2018 Mar;108:999-1009.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Rabbit Monoclonal HIF-1 alpha Antibody (2443B)
NBP2-75977SS 0.025 mg

Rabbit Monoclonal HIF-1 alpha Antibody (2443B)

Ask
View Details
Mouse RMI2 siRNA
abx931602-01 15 nmol

Mouse RMI2 siRNA

Ask
View Details
Mouse RMI2 siRNA
abx931602-02 30 nmol

Mouse RMI2 siRNA

Ask
View Details
ERAS Human shRNA Lentiviral Particle (Locus ID 3266)
TL304744V 500 µL Each

ERAS Human shRNA Lentiviral Particle (Locus ID 3266)

Ask
View Details
Lentiviral human PSMD12 shRNA (UAS) - Lentiviral human PSMD12 shRNA (UAS, RFP) (100)
GTR15317979 1 Vial

Lentiviral human PSMD12 shRNA (UAS) - Lentiviral human PSMD12 shRNA (UAS, RFP) (100)

Ask
View Details
5-Amino-4-cyano-1- (2-hydroethyl) pyrazole
sc-481186 1 g

5-Amino-4-cyano-1- (2-hydroethyl) pyrazole

Ask
View Details