Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGF-21, Mouse

FGF-21 Protein, Mouse emerges as a metabolic hormone involved in the regulation of glucose, lipid, bile acid, and phosphate metabolism.

Product Specifications

Product Name Alternative

FGF-21 Protein, Mouse, Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Applications

Metabolism-protein/nucleotide metabolism

Assay Protocol

https://www.medchemexpress.com/cytokines/fgf-21-protein-mouse.html

Purity

98.0

Smiles

AYPIPDSSPLLQFGGQVRQRYLYTDDDQDTEAHLEIREDGTVVGAAHRSPESLLELKALKPGVIQILGVKASRFLCQQPDGALYGSPHFDPEACSFRELLLEDGYNVYQSEAHGLPLRLPQKDSPNQDATSWGPVRFLPMPGLLHEPQDQAGFLPPEPPDVGSSDPLSMVEPLQGRSPSYAS

Molecular Formula

56636 (Gene_ID) Q9JJN1 (A29-S210) (Accession)

Molecular Weight

Approximately 19-23 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Xu J, et al. Fibroblast growth factor 21 reverses hepatic steatosis, increases energy expenditure, and improves insulin sensitivity in diet-induced obese mice. Diabetes. 2009 Jan;58 (1) :250-9.|[2]Coskun T, et al. Fibroblast growth factor 21 corrects obesity in mice. Endocrinology. 2008 Dec;149 (12) :6018-27.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Prostate
CS704583 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
IGF2BP1 (NM_006546) Human Over-expression Lysate
LY401963 100 µg

IGF2BP1 (NM_006546) Human Over-expression Lysate

Sign In for Pricing
View Details
Human TNFRSF1B Antibody Pair Set
E-KAB-0226 50 µL & 100 µg

Human TNFRSF1B Antibody Pair Set

Sign In for Pricing
View Details
Telotristat Ethyl
TRC-T017098-5MG 5 mg

Telotristat Ethyl

Sign In for Pricing
View Details
CA9 Polyclonal Antibody
E-AB-13968-01 20 µL

CA9 Polyclonal Antibody

Sign In for Pricing
View Details
CA9 Polyclonal Antibody
E-AB-13968-02 60 µL

CA9 Polyclonal Antibody

Sign In for Pricing
View Details