Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGF-21, Mouse

FGF-21 Protein, Mouse emerges as a metabolic hormone involved in the regulation of glucose, lipid, bile acid, and phosphate metabolism.

Product Specifications

Product Name Alternative

FGF-21 Protein, Mouse, Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Applications

Metabolism-protein/nucleotide metabolism

Assay Protocol

https://www.medchemexpress.com/cytokines/fgf-21-protein-mouse.html

Purity

98.0

Smiles

AYPIPDSSPLLQFGGQVRQRYLYTDDDQDTEAHLEIREDGTVVGAAHRSPESLLELKALKPGVIQILGVKASRFLCQQPDGALYGSPHFDPEACSFRELLLEDGYNVYQSEAHGLPLRLPQKDSPNQDATSWGPVRFLPMPGLLHEPQDQAGFLPPEPPDVGSSDPLSMVEPLQGRSPSYAS

Molecular Formula

56636 (Gene_ID) Q9JJN1 (A29-S210) (Accession)

Molecular Weight

Approximately 19-23 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Xu J, et al. Fibroblast growth factor 21 reverses hepatic steatosis, increases energy expenditure, and improves insulin sensitivity in diet-induced obese mice. Diabetes. 2009 Jan;58 (1) :250-9.|[2]Coskun T, et al. Fibroblast growth factor 21 corrects obesity in mice. Endocrinology. 2008 Dec;149 (12) :6018-27.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Tetrahymena thermophila 60S ribosomal protein L34 (RPL34)
MBS1128919-01 0.02 mg (E-Coli)

Recombinant Tetrahymena thermophila 60S ribosomal protein L34 (RPL34)

Sign In for Pricing
View Details
Recombinant Tetrahymena thermophila 60S ribosomal protein L34 (RPL34)
MBS1128919-02 0.1 mg (E-Coli)

Recombinant Tetrahymena thermophila 60S ribosomal protein L34 (RPL34)

Sign In for Pricing
View Details
Recombinant Tetrahymena thermophila 60S ribosomal protein L34 (RPL34)
MBS1128919-03 0.02 mg (Yeast)

Recombinant Tetrahymena thermophila 60S ribosomal protein L34 (RPL34)

Sign In for Pricing
View Details
Recombinant Tetrahymena thermophila 60S ribosomal protein L34 (RPL34)
MBS1128919-04 0.1 mg (Yeast)

Recombinant Tetrahymena thermophila 60S ribosomal protein L34 (RPL34)

Sign In for Pricing
View Details
Recombinant Tetrahymena thermophila 60S ribosomal protein L34 (RPL34)
MBS1128919-05 0.02 mg (Baculovirus)

Recombinant Tetrahymena thermophila 60S ribosomal protein L34 (RPL34)

Sign In for Pricing
View Details
Recombinant Tetrahymena thermophila 60S ribosomal protein L34 (RPL34)
MBS1128919-06 0.02 mg (Mammalian-Cell)

Recombinant Tetrahymena thermophila 60S ribosomal protein L34 (RPL34)

Sign In for Pricing
View Details