Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Calcineurin B, Human (His)

Calcineurin B Protein, Human (His) expresses in E. coli with a His tag at the N-terminus. Calcineurin Subunit B Type 1 is an anti-tumor factor[1].

Product Specifications

Product Name Alternative

Calcineurin B Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/calcineurin-b-protein-human-his.html

Purity

96.31

Smiles

MGNEASYPLEMCSHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNPLVQRVIDIFDTDGNGEVDFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDGYISNGELFQVLKMMVGNNLKDTQLQQIVDKTIINADKDGDGRISFEEFCAVVGGLDIHKKMVVDV

Molecular Formula

5534 (Gene_ID) P63098 (M1-V170) (Accession)

Molecular Weight

Approximately 18.0 kDa

References & Citations

[1]Lian Gui, et al. Effects of let-7e on LPS-Stimulated THP-1 Cells Assessed by iTRAQ Proteomic Analysis. Proteomics Clin Appl. 2018 Sep;12 (5) :e1700012.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mrpl52 (NM_026851) Mouse Tagged ORF Clone Lentiviral Particle
MR220181L3V 200 µL

Mrpl52 (NM_026851) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Rere (NM_001085492) Mouse Tagged Lenti ORF Clone
MR219687L4 10 µg

Rere (NM_001085492) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
TRAJ19 ORF Vector (Human) (pORF)
ORF034227 1.0 µg DNA

TRAJ19 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
SPAG7 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)
45189065 1.0 µg DNA

SPAG7 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Econazole Nitrate discontinued see RM-M031402
RG-A260640-01 10 mg

Econazole Nitrate discontinued see RM-M031402

Sign In for Pricing
View Details
Econazole Nitrate discontinued see RM-M031402
RG-A260640-02 25 mg

Econazole Nitrate discontinued see RM-M031402

Sign In for Pricing
View Details