Calcineurin B, Human (His)
Calcineurin B Protein, Human (His) expresses in E. coli with a His tag at the N-terminus. Calcineurin Subunit B Type 1 is an anti-tumor factor[1].
Product Specifications
Product Name Alternative
Calcineurin B Protein, Human (His), Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/calcineurin-b-protein-human-his.html
Purity
96.31
Smiles
MGNEASYPLEMCSHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNPLVQRVIDIFDTDGNGEVDFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDGYISNGELFQVLKMMVGNNLKDTQLQQIVDKTIINADKDGDGRISFEEFCAVVGGLDIHKKMVVDV
Molecular Formula
5534 (Gene_ID) P63098 (M1-V170) (Accession)
Molecular Weight
Approximately 18.0 kDa
References & Citations
[1]Lian Gui, et al. Effects of let-7e on LPS-Stimulated THP-1 Cells Assessed by iTRAQ Proteomic Analysis. Proteomics Clin Appl. 2018 Sep;12 (5) :e1700012.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
More Discoveries
Explore Other Products
Browse additional items from our catalog
ELA-E0868Gu 96 Tests
Guinea Pig Endothelial nitric oxide synthase ELISA Kit
Sign In for Pricing
View Details 
RC221983L3V 200 µL
LUZP2 (NM_001009909) Human Tagged ORF Clone Lentiviral Particle
Sign In for Pricing
View Details 
PDEH100592-01 20 µg
Recombinant Human CXCL4/CXCL4/PF4 Protein (Trx Tag)
Sign In for Pricing
View Details PDEH100592-02 100 µg
Recombinant Human CXCL4/CXCL4/PF4 Protein (Trx Tag)
Sign In for Pricing
View Details PDEH100592-03 500 µg
Recombinant Human CXCL4/CXCL4/PF4 Protein (Trx Tag)
Sign In for Pricing
View Details