Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Calcineurin B, Human (His)

Calcineurin B Protein, Human (His) expresses in E. coli with a His tag at the N-terminus. Calcineurin Subunit B Type 1 is an anti-tumor factor[1].

Product Specifications

Product Name Alternative

Calcineurin B Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/calcineurin-b-protein-human-his.html

Purity

96.31

Smiles

MGNEASYPLEMCSHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNPLVQRVIDIFDTDGNGEVDFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDGYISNGELFQVLKMMVGNNLKDTQLQQIVDKTIINADKDGDGRISFEEFCAVVGGLDIHKKMVVDV

Molecular Formula

5534 (Gene_ID) P63098 (M1-V170) (Accession)

Molecular Weight

Approximately 18.0 kDa

References & Citations

[1]Lian Gui, et al. Effects of let-7e on LPS-Stimulated THP-1 Cells Assessed by iTRAQ Proteomic Analysis. Proteomics Clin Appl. 2018 Sep;12 (5) :e1700012.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

HSD17B13 sgRNA CRISPR Lentivector (Human) (Target 1)
K0994402 1.0 µg DNA

HSD17B13 sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Anti-RALGPS1 antibody
STJ117027 100 µl

Anti-RALGPS1 antibody

Sign In for Pricing
View Details
C7orf20 Antibody
abx146403-01 100 µg

C7orf20 Antibody

Sign In for Pricing
View Details
C7orf20 Antibody
abx146403-02 1 mg

C7orf20 Antibody

Sign In for Pricing
View Details
Recombinant Human DYNC2LI1 Protein, His, E.coli-50ug
QP7924-ec-50ug 50ug

Recombinant Human DYNC2LI1 Protein, His, E.coli-50ug

Sign In for Pricing
View Details
SKP2 Human shRNA Lentiviral Particle (Locus ID 6502)
TL301684V 500 µL Each

SKP2 Human shRNA Lentiviral Particle (Locus ID 6502)

Sign In for Pricing
View Details