Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Calcineurin B, Human (His)

Calcineurin B Protein, Human (His) expresses in E. coli with a His tag at the N-terminus. Calcineurin Subunit B Type 1 is an anti-tumor factor[1].

Product Specifications

Product Name Alternative

Calcineurin B Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/calcineurin-b-protein-human-his.html

Purity

96.31

Smiles

MGNEASYPLEMCSHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNPLVQRVIDIFDTDGNGEVDFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDGYISNGELFQVLKMMVGNNLKDTQLQQIVDKTIINADKDGDGRISFEEFCAVVGGLDIHKKMVVDV

Molecular Formula

5534 (Gene_ID) P63098 (M1-V170) (Accession)

Molecular Weight

Approximately 18.0 kDa

References & Citations

[1]Lian Gui, et al. Effects of let-7e on LPS-Stimulated THP-1 Cells Assessed by iTRAQ Proteomic Analysis. Proteomics Clin Appl. 2018 Sep;12 (5) :e1700012.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CHCHD3 3'UTR Luciferase Stable Cell Line
TU004319 1.0 mL

CHCHD3 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Pipettes fix volume 5 µL, autoclavable
LHP2-F5 1 Each

Pipettes fix volume 5 µL, autoclavable

Sign In for Pricing
View Details
Mouse Monoclonal beta-III Tubulin Antibody (TUBB3/3732)
NBP3-07386-20ug 20 µg

Mouse Monoclonal beta-III Tubulin Antibody (TUBB3/3732)

Sign In for Pricing
View Details
Rabbit Polyclonal CXCL2/GRO beta/MIP-2/CINC-3 Antibody [FITC]
NBP2-99401F 0.1 mL

Rabbit Polyclonal CXCL2/GRO beta/MIP-2/CINC-3 Antibody [FITC]

Sign In for Pricing
View Details
MDGA2 (NM_182830) Human Tagged ORF Clone
RC223142 10 µg

MDGA2 (NM_182830) Human Tagged ORF Clone

Sign In for Pricing
View Details
Vps26a (NM_133672) Mouse Tagged ORF Clone
MG204799 10 µg

Vps26a (NM_133672) Mouse Tagged ORF Clone

Sign In for Pricing
View Details