Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Calcineurin B, Human (His)

Calcineurin B Protein, Human (His) expresses in E. coli with a His tag at the N-terminus. Calcineurin Subunit B Type 1 is an anti-tumor factor[1].

Product Specifications

Product Name Alternative

Calcineurin B Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/calcineurin-b-protein-human-his.html

Purity

96.31

Smiles

MGNEASYPLEMCSHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNPLVQRVIDIFDTDGNGEVDFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDGYISNGELFQVLKMMVGNNLKDTQLQQIVDKTIINADKDGDGRISFEEFCAVVGGLDIHKKMVVDV

Molecular Formula

5534 (Gene_ID) P63098 (M1-V170) (Accession)

Molecular Weight

Approximately 18.0 kDa

References & Citations

[1]Lian Gui, et al. Effects of let-7e on LPS-Stimulated THP-1 Cells Assessed by iTRAQ Proteomic Analysis. Proteomics Clin Appl. 2018 Sep;12 (5) :e1700012.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ptbp1 3'UTR GFP Stable Cell Line
TU167215 1.0 mL

Ptbp1 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Goat Macrophage Migration Inhibitory Factor (MIF) ELISA Kit
EIA06046Go 1 Kit

Goat Macrophage Migration Inhibitory Factor (MIF) ELISA Kit

Sign In for Pricing
View Details
MIA) Human ELISA Kit
E9875 96 Tests

MIA) Human ELISA Kit

Sign In for Pricing
View Details
Rat Monoclonal EPCR Antibody (RCR-252) [DyLight 405]
NB600-963V 0.1 mL

Rat Monoclonal EPCR Antibody (RCR-252) [DyLight 405]

Sign In for Pricing
View Details
TRNAL34 Protein Vector (Human) (pPB-N-His)
PV139367 500 ng

TRNAL34 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
Recombinant Human CCPG1 Protein, N-His
HA086012-01 50 µg

Recombinant Human CCPG1 Protein, N-His

Sign In for Pricing
View Details