Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Calcineurin B, Human (His)

Calcineurin B Protein, Human (His) expresses in E. coli with a His tag at the N-terminus. Calcineurin Subunit B Type 1 is an anti-tumor factor[1].

Product Specifications

Product Name Alternative

Calcineurin B Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/calcineurin-b-protein-human-his.html

Purity

96.31

Smiles

MGNEASYPLEMCSHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNPLVQRVIDIFDTDGNGEVDFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDGYISNGELFQVLKMMVGNNLKDTQLQQIVDKTIINADKDGDGRISFEEFCAVVGGLDIHKKMVVDV

Molecular Formula

5534 (Gene_ID) P63098 (M1-V170) (Accession)

Molecular Weight

Approximately 18.0 kDa

References & Citations

[1]Lian Gui, et al. Effects of let-7e on LPS-Stimulated THP-1 Cells Assessed by iTRAQ Proteomic Analysis. Proteomics Clin Appl. 2018 Sep;12 (5) :e1700012.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal KIST Antibody (OTI2H4) [DyLight 405]
NBP2-72383V 0.1 mL

Mouse Monoclonal KIST Antibody (OTI2H4) [DyLight 405]

Sign In for Pricing
View Details
hsa-mir-184 RT-PCR Detection and U6 Calibration Kit
abx096514-01 50 Reactions

hsa-mir-184 RT-PCR Detection and U6 Calibration Kit

Sign In for Pricing
View Details
hsa-mir-184 RT-PCR Detection and U6 Calibration Kit
abx096514-02 100 Reactions

hsa-mir-184 RT-PCR Detection and U6 Calibration Kit

Sign In for Pricing
View Details
hsa-mir-184 RT-PCR Detection and U6 Calibration Kit
abx096514-03 200 Reactions

hsa-mir-184 RT-PCR Detection and U6 Calibration Kit

Sign In for Pricing
View Details
SSB CRISPRa sgRNA lentivector (set of three targets)(Rat)
45531126 3x 1.0µg DNA

SSB CRISPRa sgRNA lentivector (set of three targets)(Rat)

Sign In for Pricing
View Details
IKKB, phosphorylated (S733) (IKBKB, IKKB, Inhibitor of nuclear factor kappa-B kinase subunit beta, I-kappa-B kinase 2, Nuclear factor NF-kappa-B inhibitor kinase beta) (MaxLight 405) discontinued
036964-ML405 100 µL

IKKB, phosphorylated (S733) (IKBKB, IKKB, Inhibitor of nuclear factor kappa-B kinase subunit beta, I-kappa-B kinase 2, Nuclear factor NF-kappa-B inhibitor kinase beta) (MaxLight 405) discontinued

Sign In for Pricing
View Details