Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Calcineurin B, Human (His)

Calcineurin B Protein, Human (His) expresses in E. coli with a His tag at the N-terminus. Calcineurin Subunit B Type 1 is an anti-tumor factor[1].

Product Specifications

Product Name Alternative

Calcineurin B Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/calcineurin-b-protein-human-his.html

Purity

96.31

Smiles

MGNEASYPLEMCSHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNPLVQRVIDIFDTDGNGEVDFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDGYISNGELFQVLKMMVGNNLKDTQLQQIVDKTIINADKDGDGRISFEEFCAVVGGLDIHKKMVVDV

Molecular Formula

5534 (Gene_ID) P63098 (M1-V170) (Accession)

Molecular Weight

Approximately 18.0 kDa

References & Citations

[1]Lian Gui, et al. Effects of let-7e on LPS-Stimulated THP-1 Cells Assessed by iTRAQ Proteomic Analysis. Proteomics Clin Appl. 2018 Sep;12 (5) :e1700012.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal ZNF655 Antibody
NBP2-88720 100 µL

Rabbit Polyclonal ZNF655 Antibody

Sign In for Pricing
View Details
AdmiRa-Off-hsa-miR-4529-5p Virus
mh6534 1.0 mL

AdmiRa-Off-hsa-miR-4529-5p Virus

Sign In for Pricing
View Details
MPP5 (MAGUK p55 Subfamily Member 5, FLJ12615, PALS1) (MaxLight 550)
MBS6385826-01 0.1 mL

MPP5 (MAGUK p55 Subfamily Member 5, FLJ12615, PALS1) (MaxLight 550)

Sign In for Pricing
View Details
MPP5 (MAGUK p55 Subfamily Member 5, FLJ12615, PALS1) (MaxLight 550)
MBS6385826-02 5x 0.1 mL

MPP5 (MAGUK p55 Subfamily Member 5, FLJ12615, PALS1) (MaxLight 550)

Sign In for Pricing
View Details
RNU7-53P Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV774426 1.0 µg DNA

RNU7-53P Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details
Mouse Monoclonal Daxx Antibody (PCRP-DAXX-8B7) [DyLight 680]
NBP3-08740FR 100 µL

Mouse Monoclonal Daxx Antibody (PCRP-DAXX-8B7) [DyLight 680]

Sign In for Pricing
View Details