Calcineurin B, Human (His)
Calcineurin B Protein, Human (His) expresses in E. coli with a His tag at the N-terminus. Calcineurin Subunit B Type 1 is an anti-tumor factor[1].
Product Specifications
Product Name Alternative
Calcineurin B Protein, Human (His), Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/calcineurin-b-protein-human-his.html
Purity
96.31
Smiles
MGNEASYPLEMCSHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNPLVQRVIDIFDTDGNGEVDFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDGYISNGELFQVLKMMVGNNLKDTQLQQIVDKTIINADKDGDGRISFEEFCAVVGGLDIHKKMVVDV
Molecular Formula
5534 (Gene_ID) P63098 (M1-V170) (Accession)
Molecular Weight
Approximately 18.0 kDa
References & Citations
[1]Lian Gui, et al. Effects of let-7e on LPS-Stimulated THP-1 Cells Assessed by iTRAQ Proteomic Analysis. Proteomics Clin Appl. 2018 Sep;12 (5) :e1700012.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
More Discoveries
Explore Other Products
Browse additional items from our catalog
![Mouse Monoclonal Bcl-xL Antibody (SPM165) [DyLight 680]](https://cdn.genprice.uk/genprice/uk/genprice5.webp)
NBP2-34743FR 0.1 mL
Mouse Monoclonal Bcl-xL Antibody (SPM165) [DyLight 680]
Sign In for Pricing
View Details 
abx325331-01 50 µg
MKI67 FHA domain-interacting nucleolar phosphoprotein Phospho-Thr234 (NIFK pT234) Antibody
Sign In for Pricing
View Details abx325331-02 100 µg
MKI67 FHA domain-interacting nucleolar phosphoprotein Phospho-Thr234 (NIFK pT234) Antibody
Sign In for Pricing
View Details 
MBS9329190-01 48 Well
Human Putative uncharacterized protein C10orf126, C10orf126 ELISA Kit
Sign In for Pricing
View Details MBS9329190-02 96 Well
Human Putative uncharacterized protein C10orf126, C10orf126 ELISA Kit
Sign In for Pricing
View Details