Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Calcineurin B, Human (His)

Calcineurin B Protein, Human (His) expresses in E. coli with a His tag at the N-terminus. Calcineurin Subunit B Type 1 is an anti-tumor factor[1].

Product Specifications

Product Name Alternative

Calcineurin B Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/calcineurin-b-protein-human-his.html

Purity

96.31

Smiles

MGNEASYPLEMCSHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNPLVQRVIDIFDTDGNGEVDFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDGYISNGELFQVLKMMVGNNLKDTQLQQIVDKTIINADKDGDGRISFEEFCAVVGGLDIHKKMVVDV

Molecular Formula

5534 (Gene_ID) P63098 (M1-V170) (Accession)

Molecular Weight

Approximately 18.0 kDa

References & Citations

[1]Lian Gui, et al. Effects of let-7e on LPS-Stimulated THP-1 Cells Assessed by iTRAQ Proteomic Analysis. Proteomics Clin Appl. 2018 Sep;12 (5) :e1700012.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human PBX2 Protein - (Dry Ice)
H00005089-P01-2ug 2 µg

Recombinant Human PBX2 Protein - (Dry Ice)

Sign In for Pricing
View Details
SCAP siRNA (Rat)
CRR4753-01 15 nmol

SCAP siRNA (Rat)

Sign In for Pricing
View Details
SCAP siRNA (Rat)
CRR4753-02 30 nmol

SCAP siRNA (Rat)

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to Haptoglobin Related Protein (HPR)
MBS2061874-01 0.1 mL

Cy3-Linked Polyclonal Antibody to Haptoglobin Related Protein (HPR)

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to Haptoglobin Related Protein (HPR)
MBS2061874-02 0.2 mL

Cy3-Linked Polyclonal Antibody to Haptoglobin Related Protein (HPR)

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to Haptoglobin Related Protein (HPR)
MBS2061874-03 0.5 mL

Cy3-Linked Polyclonal Antibody to Haptoglobin Related Protein (HPR)

Sign In for Pricing
View Details