Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Calcineurin B, Human (His)

Calcineurin B Protein, Human (His) expresses in E. coli with a His tag at the N-terminus. Calcineurin Subunit B Type 1 is an anti-tumor factor[1].

Product Specifications

Product Name Alternative

Calcineurin B Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/calcineurin-b-protein-human-his.html

Purity

96.31

Smiles

MGNEASYPLEMCSHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNPLVQRVIDIFDTDGNGEVDFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDGYISNGELFQVLKMMVGNNLKDTQLQQIVDKTIINADKDGDGRISFEEFCAVVGGLDIHKKMVVDV

Molecular Formula

5534 (Gene_ID) P63098 (M1-V170) (Accession)

Molecular Weight

Approximately 18.0 kDa

References & Citations

[1]Lian Gui, et al. Effects of let-7e on LPS-Stimulated THP-1 Cells Assessed by iTRAQ Proteomic Analysis. Proteomics Clin Appl. 2018 Sep;12 (5) :e1700012.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pnliprp1 (NM_032081) Rat Untagged Clone
RN210658 10 µg

Pnliprp1 (NM_032081) Rat Untagged Clone

Sign In for Pricing
View Details
Oxr1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)
K4479908 1.0 µg DNA

Oxr1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
Unc13c Mouse shRNA Lentiviral Particle (Locus ID 208898)
TL517901V 500 µL Each

Unc13c Mouse shRNA Lentiviral Particle (Locus ID 208898)

Sign In for Pricing
View Details
LDLRAP1 Rabbit pAb (APR27100N)
APR27100N-01 50 µL

LDLRAP1 Rabbit pAb (APR27100N)

Sign In for Pricing
View Details
LDLRAP1 Rabbit pAb (APR27100N)
APR27100N-02 100 µL

LDLRAP1 Rabbit pAb (APR27100N)

Sign In for Pricing
View Details
LDLRAP1 Rabbit pAb (APR27100N)
APR27100N-03 200 µL

LDLRAP1 Rabbit pAb (APR27100N)

Sign In for Pricing
View Details