Calcineurin B, Human (His)
Calcineurin B Protein, Human (His) expresses in E. coli with a His tag at the N-terminus. Calcineurin Subunit B Type 1 is an anti-tumor factor[1].
Product Specifications
Product Name Alternative
Calcineurin B Protein, Human (His), Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/calcineurin-b-protein-human-his.html
Purity
96.31
Smiles
MGNEASYPLEMCSHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNPLVQRVIDIFDTDGNGEVDFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDGYISNGELFQVLKMMVGNNLKDTQLQQIVDKTIINADKDGDGRISFEEFCAVVGGLDIHKKMVVDV
Molecular Formula
5534 (Gene_ID) P63098 (M1-V170) (Accession)
Molecular Weight
Approximately 18.0 kDa
References & Citations
[1]Lian Gui, et al. Effects of let-7e on LPS-Stimulated THP-1 Cells Assessed by iTRAQ Proteomic Analysis. Proteomics Clin Appl. 2018 Sep;12 (5) :e1700012.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
More Discoveries
Explore Other Products
Browse additional items from our catalog
381722 100 µL
TCF11/NRF1 (alpha Pal, alpha Palindromic Binding Protein, Alpha Palindromic-Binding Protein, Alpha-pal, Locus Control Region Factor 1, NFE2 Related Factor 1, NRF-1, Nrf1, NRF1_HUMAN, Nuclear Respiratory Factor 1, Transcription Factor 11)
Sign In for Pricing
View Details 
K7562106 1.0 µg DNA
Hdhd1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)
Sign In for Pricing
View Details MBS7260236-01 48 Well
Goat Tryptophan 5 Hydroxylase 1 (TPH1) ELISA Kit
Sign In for Pricing
View Details 
MBS7260236-02 96 Well
Goat Tryptophan 5 Hydroxylase 1 (TPH1) ELISA Kit
Sign In for Pricing
View Details MBS7260236-03 5x 96 Well
Goat Tryptophan 5 Hydroxylase 1 (TPH1) ELISA Kit
Sign In for Pricing
View Details MBS7260236-04 10x 96 Well
Goat Tryptophan 5 Hydroxylase 1 (TPH1) ELISA Kit
Sign In for Pricing
View Details