Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Chlorobium tepidum Polyphosphate kinase 2 (ppk2), partial

Product Specifications

Product Name Alternative

ATP-polyphosphate phosphotransferase 2 Polyphosphoric acid kinase 2

Abbreviation

Recombinant Chlorobaculum tepidum ppk2 protein, partial

Gene Name

Ppk2

UniProt

O68984

Expression Region

140-343aa

Organism

Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) (Chlorobium tepidum)

Target Sequence

EQQQLLQHYFRKEVFPVLTPLAFDTGHPFPFMSNLSLNLAIELEDEESGAIKFARVKVPGILSRIIRLDQIEGLGFDDGRIRLLWLEDLVEHNLDQLFPKMRILQCHPFRIIRDADIEIEEDEAGDLLESIEQGVRSRRYGKVVRLDINPDMPHSIRSLLVKNLETYERNVYEIGGVLGMSALMELLKIDRPDLKDELFVPNNP

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

Catalyzes the reversible transfer of the terminal phosphate of ATP to form a long-chain polyphosphate (polyP) .

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

34.4 kDa

References & Citations

"The complete genome sequence of Chlorobium tepidum TLS, a photosynthetic, anaerobic, green-sulfur bacterium." Eisen J.A., Nelson K.E., Paulsen I.T., Heidelberg J.F., Wu M., Dodson R.J., DeBoy R.T., Gwinn M.L., Nelson W.C., Haft D.H., Hickey E.K., Peterson J.D., Durkin A.S., Kolonay J.F., Yang F., Holt I.E., Umayam L.A., Mason T.M. Fraser C.M. Proc. Natl. Acad. Sci. U.S.A. 99:9509-9514 (2002)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RNF31 Antibody
KC-15762-01 50 μL

RNF31 Antibody

Sign In for Pricing
View Details
RNF31 Antibody
KC-15762-02 100 µL

RNF31 Antibody

Sign In for Pricing
View Details
RNF31 Antibody
KC-15762-03 1 mL

RNF31 Antibody

Sign In for Pricing
View Details
SGK2 Polyclonal Antibody
E-AB-90354-01 60 µL

SGK2 Polyclonal Antibody

Sign In for Pricing
View Details
SGK2 Polyclonal Antibody
E-AB-90354-02 120 µL

SGK2 Polyclonal Antibody

Sign In for Pricing
View Details
SGK2 Polyclonal Antibody
E-AB-90354-03 200 µL

SGK2 Polyclonal Antibody

Sign In for Pricing
View Details