Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MIP-1 alpha/CCL3, Mouse (HEK293)

MIP-1 alpha/CCL3 Protein, Mouse (HEK293), an important chemokine, is a key regulator of immune microenvironment and primarily mediates the trafficking of immune cells in both inflammation and cancer. MIP-1 alpha/CCL3 Protein, Mouse (HEK293) is a recombinant mouse CCL3 expressed by HEK293[1].

Product Specifications

Product Name Alternative

MIP-1 alpha/CCL3 Protein, Mouse (HEK293), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mip-1-alpha-ccl3-protein-mouse-hek293.html

Purity

95.00

Smiles

APYGADTPTACCFSYSRKIPRQFIVDYFETSSLCSQPGVIFLTKRNRQICADSKETWVQEYITDLELNA

Molecular Formula

20302 (Gene_ID) P10855 (A24-A92) (Accession)

Molecular Weight

Approximately 5-10 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Zhang G, et al. CCL3 participates in the development of rheumatoid arthritis by activating AKT. Eur Rev Med Pharmacol Sci. 2018 Oct;22 (20) :6625-6632.|[2]Zhang G, et al. CCL3 participates in the development of rheumatoid arthritis by activating AKT. Eur Rev Med Pharmacol Sci. 2018 Oct;22 (20) :6625-6632.|[3]Giovanni Bernardini, et al. CCL3 and CXCL12 regulate trafficking of mouse bone marrow NK cell subsets. Blood. 2008 Apr 1;111 (7) :3626-34.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Granzyme A (APC) discontinued
G8956-05 100 Tests

Granzyme A (APC) discontinued

Sign In for Pricing
View Details
Rat Rala / Ras-related protein Ral-A ELISA Kit
MBS2906190-01 48 Well

Rat Rala / Ras-related protein Ral-A ELISA Kit

Sign In for Pricing
View Details
Rat Rala / Ras-related protein Ral-A ELISA Kit
MBS2906190-02 96 Well

Rat Rala / Ras-related protein Ral-A ELISA Kit

Sign In for Pricing
View Details
Rat Rala / Ras-related protein Ral-A ELISA Kit
MBS2906190-03 5x 96 Well

Rat Rala / Ras-related protein Ral-A ELISA Kit

Sign In for Pricing
View Details
Rat Rala / Ras-related protein Ral-A ELISA Kit
MBS2906190-04 10x 96 Well

Rat Rala / Ras-related protein Ral-A ELISA Kit

Sign In for Pricing
View Details
ZNF571 Antibody (N-term) Blocking Peptide
MBS9222600-01 0.5 mg

ZNF571 Antibody (N-term) Blocking Peptide

Sign In for Pricing
View Details