Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DDX19A, Human (His-SUMO)

The DDX19A protein is an ATP-dependent RNA helicase that plays a crucial role in unwinding single- and double-stranded DNA in the 3'-5' direction. It is actively involved in DNA replication and repair by recruiting DNA2 to aid in 5' end resection during double-strand break repair. DDX19A Protein, Human (His-SUMO) is the recombinant human-derived DDX19A protein, expressed by E. coli , with N-6*His, N-SUMO labeled tag.

Product Specifications

Product Name Alternative

DDX19A Protein, Human (His-SUMO), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ddx19a-protein-human-his-sumo.html

Smiles

MATDSWALAVDEQEAAVKSMTNLQIKEEKVKADTNGIIKTSTTAEKTDEEEKEDRAAQSLLNKLIRSNLVDNTNQVEVLQRDPNSPLYSVKSFEELRLKPQLLQGVYAMGFNRPSKIQENALPMMLAEPPQNLIAQSQSGTGKTAAFVLAMLSRVEPSDRYPQCLCLSPTYELALQTGKVIEQMGKFYPELKLAYAVRGNKLERGQKISEQIVIGTPGTVLDWCSKLKFIDPKKIKVFVLDEADVMIATQGHQDQSIRIQRMLPRNCQMLLFSATFEDSVWKFAQKVVPDPNVIKLKREEETLDTIKQYYVLCSSRDEKFQALCNLYGAITIAQAMIFCHTRKTASWLAAELSKEGHQVALLSGEMMVEQRAAVIERFREGKEKVLVTTNVCARGIDVEQVSVVINFDLPVDKDGNPDNETYLHRIGRTGRFGKRGLAVNMVDSKHSMNILNRIQEHFNKKIERLDTDDLDEIEKIAN

Molecular Formula

55308 (Gene_ID) Q9NUU7-1 (M1-N478) (Accession)

Molecular Weight

Approximately 70.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MUC2 (MLP/842), CF488A conjugate, 0.1mg/mL
BNC880842-100 1x 100 µL

MUC2 (MLP/842), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HNRPM (HNRNPM) (NM_031203) Human Over-expression Lysate
LC403103 20 µg

HNRPM (HNRNPM) (NM_031203) Human Over-expression Lysate

Sign In for Pricing
View Details
RALBP1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI6G10]
TA500915BM 100 µL

RALBP1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI6G10]

Sign In for Pricing
View Details
SPATA22 (NM_001170698) Human Over-expression Lysate
LC432942 20 µg

SPATA22 (NM_001170698) Human Over-expression Lysate

Sign In for Pricing
View Details
FHL2 (NM_201557) Human Over-expression Lysate
LC404460 20 µg

FHL2 (NM_201557) Human Over-expression Lysate

Sign In for Pricing
View Details
KLK15 Monoclonal Antibody
AN200129P 100 µL

KLK15 Monoclonal Antibody

Sign In for Pricing
View Details