Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DDX19A, Human (His-SUMO)

The DDX19A protein is an ATP-dependent RNA helicase that plays a crucial role in unwinding single- and double-stranded DNA in the 3'-5' direction. It is actively involved in DNA replication and repair by recruiting DNA2 to aid in 5' end resection during double-strand break repair. DDX19A Protein, Human (His-SUMO) is the recombinant human-derived DDX19A protein, expressed by E. coli , with N-6*His, N-SUMO labeled tag.

Product Specifications

Product Name Alternative

DDX19A Protein, Human (His-SUMO), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ddx19a-protein-human-his-sumo.html

Smiles

MATDSWALAVDEQEAAVKSMTNLQIKEEKVKADTNGIIKTSTTAEKTDEEEKEDRAAQSLLNKLIRSNLVDNTNQVEVLQRDPNSPLYSVKSFEELRLKPQLLQGVYAMGFNRPSKIQENALPMMLAEPPQNLIAQSQSGTGKTAAFVLAMLSRVEPSDRYPQCLCLSPTYELALQTGKVIEQMGKFYPELKLAYAVRGNKLERGQKISEQIVIGTPGTVLDWCSKLKFIDPKKIKVFVLDEADVMIATQGHQDQSIRIQRMLPRNCQMLLFSATFEDSVWKFAQKVVPDPNVIKLKREEETLDTIKQYYVLCSSRDEKFQALCNLYGAITIAQAMIFCHTRKTASWLAAELSKEGHQVALLSGEMMVEQRAAVIERFREGKEKVLVTTNVCARGIDVEQVSVVINFDLPVDKDGNPDNETYLHRIGRTGRFGKRGLAVNMVDSKHSMNILNRIQEHFNKKIERLDTDDLDEIEKIAN

Molecular Formula

55308 (Gene_ID) Q9NUU7-1 (M1-N478) (Accession)

Molecular Weight

Approximately 70.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human KIBRA (WWC1) activation kit by CRISPRa
GA108191 1 Kit

Human KIBRA (WWC1) activation kit by CRISPRa

Sign In for Pricing
View Details
Des-(3-Indolyl) 3-(Phenylamino) Tryptophan
TRC-T947295-100MG 100 mg

Des-(3-Indolyl) 3-(Phenylamino) Tryptophan

Sign In for Pricing
View Details
1-Hexene
TRC-H294851-50G 50 g

1-Hexene

Sign In for Pricing
View Details
Tissue FFPE Sections, Stomach
CS707617 5x 5 µm

Tissue FFPE Sections, Stomach

Sign In for Pricing
View Details
Rottlerin
SIH-394-50MG 50 mg

Rottlerin

Sign In for Pricing
View Details
PP1C gamma Rabbit Polyclonal Antibody
HA500138 100 µL

PP1C gamma Rabbit Polyclonal Antibody

Sign In for Pricing
View Details