Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HCoV-OC43 Spike/S (sf9, His, myc)

HCoV-OC43 Spike/S Protein, particularly the S1 subunit, initiates infection by attaching the virion to the cell membrane. It interacts with sialic acid-containing cell receptors, facilitating virus binding and marking the initial step in the infection process, establishing a connection with the host receptor for infection commencement. HCoV-OC43 Spike/S Protein (sf9, His, myc) is the recombinant Virus-derived HCoV-OC43 Spike/S protein, expressed by sf9 insect cells , with C-Myc, N-10*His labeled tag.

Product Specifications

Product Name Alternative

HCoV-OC43 Spike/S Protein (sf9, His, myc), Virus, Sf9 insect cells

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/coronavirus-oc43-spike-glycoprotein-human-sf9-his-myc.html

Purity

90.0

Smiles

VIGDLKCTSDNINDKDTGPPPISTDTVDVTNGLGTYYVLDRVYLNTTLFLNGYYPTSGSTYRNMALKGSVLLSRLWFKPPFLSDFINGIFAKVKNTKVIKDRVMYSEFPAITIGSTFVNTSYSVVVQPRTINSTQDGDNKLQGLLEVSVCQYNMCEYPQTICHPNLGNHRKELWHLDTGVVSCLYKRNFTYDVNADYLYFHFYQEGGTFYAYFTDTGVVTKFLFNVYLGMALSHYYVMPLTCNSKLTLEYWVTPLTSRQYLLAFNQDGIIFNAEDCMSDFMSEIKCKTQSIAPPTGVYELNGYTVQPIADVYRRKPNLPNCNIEAWLNDK

Molecular Formula

/ (Gene_ID) P36334 (V15-K344) (Accession)

Molecular Weight

Approximately 41.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MUC2 (CCP58), CF640R conjugate, 0.1mg/mL
BNC400032-500 1x 500 µL

MUC2 (CCP58), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD86 (BU63), CF740 conjugate, 0.1mg/mL
BNC740193-100 1x 100 µL

CD86 (BU63), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (TV-1), CF594 conjugate, 0.1mg/mL
BNC940029-500 1x 500 µL

Fibronectin (TV-1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD95 (B-R18), CF405S conjugate, 0.1mg/mL
BNC040305-500 1x 500 µL

CD95 (B-R18), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD43 (84-3C1), CF740 conjugate, 0.1mg/mL
BNC740342-100 1x 100 µL

CD43 (84-3C1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cyclin A2 (E67), CF640R conjugate, 0.1mg/mL
BNC400673-100 1x 100 µL

Cyclin A2 (E67), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details