Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LILRB1/CD85j/ILT2, Rhesus Macaque (HEK293, His)

LILRB1/CD85j/ILT2 Protein is an inhibitory receptor broadly expressed on leukocytes and recognizes HLA-class I and human cytomegalovirus UL18[1]. LILRB1/CD85j/ILT2 Protein, Rhesus Macaque (HEK293, His) is the recombinant Rhesus Macaque-derived LILRB1/CD85j/ILT2 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

LILRB1/CD85j/ILT2 Protein, Rhesus Macaque (HEK293, His), Rhesus Macaque, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/lilrb1-cd85j-ilt2-protein-rhesus-macaque-hek-293-his.html

Purity

95.0

Smiles

SRTRVQAGTFPKPTLWAEPGSMISKGSPVTLRCQGSLPVQDYRLQREKKTASWVRRIQQELVKKGYFPIASITSEHAGQYRCQYYSHSWWSEPSDPLELVVTGAYSKPTLSALPSPVVASGGNVTLQCDSQVAGGFVLCKEGEDEHPQCLNSQPHTRGSSRAVFSVGPVSPSRRWSYRCYGYDSRSPYVWSLPSDLLELLVPGVSKKPSLSVQPGPVVAPGDKLTLQCGSDAGYNRFALYKEGERDFLQRPGRQPQAGLSQANFLLDPVRRSHGGQYRCSGAHNLSSEWSAPSDPLDILIAGQIRGRPSLLVQPGPTVVSGENVTLLCQSSWQFHVFLLTQAGAADAHLHLRSMYKYPKYQAEFPMSPVTSAHAGTYRCYGSHSSDSYLLSIPSDPLELVVSGPSGGPSSPTTGPTSTCGPEDQPLTPTGSDPQSGLGRH

Molecular Formula

692340 (Gene_ID) F7H3G7 (S17-H456) (Accession)

Molecular Weight

60-85 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Anti-IκB-α/NFKBIA Polyclonal Antibody
PAV8354 100 μL

Rabbit Anti-IκB-α/NFKBIA Polyclonal Antibody

Sign In for Pricing
View Details
Chd9 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
16047114 3x 1.0 µg

Chd9 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
Rabbit Polyclonal CHID1 Antibody
NBP2-82674-0.1mL 0.1 mL

Rabbit Polyclonal CHID1 Antibody

Sign In for Pricing
View Details
Anti-PCSK9 Neutralizing Antibody
71207 50 µg

Anti-PCSK9 Neutralizing Antibody

Sign In for Pricing
View Details
Cnu Antibody
orb811476 2 mg

Cnu Antibody

Sign In for Pricing
View Details
Mouse IGSF2/CD101 MAb (Clone 307707)
MAB3368-SP 25 µg

Mouse IGSF2/CD101 MAb (Clone 307707)

Sign In for Pricing
View Details