Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SCF, Mouse (P.pastoris)

SCF Protein, Mouse (P.pastoris) is the ligand for the receptor-type protein-tyrosine kinase KIT.It plays an essential role in the regulation of cell survival and proliferation, hematopoiesis, stem cell maintenance, gametogenesis, mast cell development, migration and function, and in melanogenesis.

Product Specifications

Product Name Alternative

SCF Protein, Mouse (P.pastoris), Mouse, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Related Pathways

Others

Assay Protocol

https://www.medchemexpress.com/cytokines/scf-protein-mouse-p-pastoris.html

Purity

96.70

Smiles

MKEICGNPVTDNVKDITKLVANLPNDYMITLNYVAGMDVLPSHCWLRDMVIQLSLSLTTLLDKFSNISEGLSNYSIIDKLGKIVDDLVLCMEENAPKNIKESPKRPETRSFTPEEFFSIFNRSIDAFKDFMVASDTSDCVLSSTLGPEKDSRVSVTKPFMLPPVA

Molecular Formula

17311 (Gene_ID) P20826 (K26-A189) (Accession)

Molecular Weight

Approximately 18.4 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Mitsunari M, et al. The potential role of stem cell factor and its receptor c-kit in the mouse blastocyst implantation. Mol Hum Reprod. 1999 Sep;5 (9) :874-9.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

FLJ14803 Antibody
GWB-MV353B 50 µg

FLJ14803 Antibody

Ask
View Details
Human STAU1 knockout cell line
ABC-KH14788 1 Vial

Human STAU1 knockout cell line

Ask
View Details
RPL37AP9 AAV Vector (Human) (CMV)
41616101 1 µg

RPL37AP9 AAV Vector (Human) (CMV)

Ask
View Details
RANGE S - Safety-barrel 10l with self-closing tap ¾", flame trap, pressure control valve and separate ventilation
S10FVS each

RANGE S - Safety-barrel 10l with self-closing tap ¾", flame trap, pressure control valve and separate ventilation

Ask
View Details
BHLHE41 (BHLHB3, Class E Basic Helix-loop-helix Protein 41, bHLHe41, Class B Basic Helix-loop-helix Protein 3, bHLHb3, Differentially Expressed in Chondrocytes Protein 2, Differentially Expressed in Chondrocytes Protein 2, hDEC2, Enhancer-of-split and Hai
MBS6221106-01 0.1 mL

BHLHE41 (BHLHB3, Class E Basic Helix-loop-helix Protein 41, bHLHe41, Class B Basic Helix-loop-helix Protein 3, bHLHb3, Differentially Expressed in Chondrocytes Protein 2, Differentially Expressed in Chondrocytes Protein 2, hDEC2, Enhancer-of-split and Hai

Ask
View Details
BHLHE41 (BHLHB3, Class E Basic Helix-loop-helix Protein 41, bHLHe41, Class B Basic Helix-loop-helix Protein 3, bHLHb3, Differentially Expressed in Chondrocytes Protein 2, Differentially Expressed in Chondrocytes Protein 2, hDEC2, Enhancer-of-split and Hai
MBS6221106-02 5x 0.1 mL

BHLHE41 (BHLHB3, Class E Basic Helix-loop-helix Protein 41, bHLHe41, Class B Basic Helix-loop-helix Protein 3, bHLHb3, Differentially Expressed in Chondrocytes Protein 2, Differentially Expressed in Chondrocytes Protein 2, hDEC2, Enhancer-of-split and Hai

Ask
View Details