Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SCF, Mouse (P.pastoris)

SCF Protein, Mouse (P.pastoris) is the ligand for the receptor-type protein-tyrosine kinase KIT.It plays an essential role in the regulation of cell survival and proliferation, hematopoiesis, stem cell maintenance, gametogenesis, mast cell development, migration and function, and in melanogenesis.

Product Specifications

Product Name Alternative

SCF Protein, Mouse (P.pastoris), Mouse, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Related Pathways

Others

Assay Protocol

https://www.medchemexpress.com/cytokines/scf-protein-mouse-p-pastoris.html

Purity

96.70

Smiles

MKEICGNPVTDNVKDITKLVANLPNDYMITLNYVAGMDVLPSHCWLRDMVIQLSLSLTTLLDKFSNISEGLSNYSIIDKLGKIVDDLVLCMEENAPKNIKESPKRPETRSFTPEEFFSIFNRSIDAFKDFMVASDTSDCVLSSTLGPEKDSRVSVTKPFMLPPVA

Molecular Formula

17311 (Gene_ID) P20826 (K26-A189) (Accession)

Molecular Weight

Approximately 18.4 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Mitsunari M, et al. The potential role of stem cell factor and its receptor c-kit in the mouse blastocyst implantation. Mol Hum Reprod. 1999 Sep;5 (9) :874-9.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ATPAF2 Polyclonal Antibody, Biotin Conjugated
A54270-100 100 µL

ATPAF2 Polyclonal Antibody, Biotin Conjugated

Sign In for Pricing
View Details
Lentiviral human NGFR shRNA (UAS) - Lentiviral human NGFR shRNA (UAS, GFP) plasmid
GTR15340969 1 Vial

Lentiviral human NGFR shRNA (UAS) - Lentiviral human NGFR shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
Phospho-PLCG 2 (Tyr1217) Polyclonal Antibody, APC-Cy5.5 Conjugated
bs-3338R-APC-Cy5.5 100 µL

Phospho-PLCG 2 (Tyr1217) Polyclonal Antibody, APC-Cy5.5 Conjugated

Sign In for Pricing
View Details
Recombinant Haemophilus Influenzae HI1086 Protein (aa 1-261)
VAng-Lsx03363-inquire Inquire

Recombinant Haemophilus Influenzae HI1086 Protein (aa 1-261)

Sign In for Pricing
View Details
HRASLS5 Protein Vector (Rat) (pPM-C-His)
PV273425 500 ng

HRASLS5 Protein Vector (Rat) (pPM-C-His)

Sign In for Pricing
View Details
CXorf57 Rabbit Polyclonal Antibody
orb182812-01 50 μL

CXorf57 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details