Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mycobacterium intracellulare Lipoprotein lpqH (lpqH)

Product Specifications

Product Name Alternative

(19 kDa lipoprotein antigen) (22 kDa lipoprotein antigen) (Mi22 antigen) (Putative transporter LpqH)

Abbreviation

Recombinant Mycobacterium intracellulare lpqH protein

Gene Name

LpqH

UniProt

P31502

Expression Region

22-162aa

Organism

Mycobacterium intracellulare

Target Sequence

CSGGNKSGTSASSSANSSGTTRRLAPGAAGTKVTIDGKDQNVSGSVVCTNAGGTINIAIGGAATGIAAVLSDGNPPQVKSVGLGNVNGVTLGYTSGTGQGNATASKDGNSYKISGTATGVDMANPMQPVNKPFEINVTCNS

Tag

N-terminal 10xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

Might be involved in ligand transport. A host TLR2 agonist, modifies host gene expression in response to pathogen.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

19.6 kDa

References & Citations

"Homologs of Mycobacterium leprae 18-kilodalton and Mycobacterium tuberculosis 19-kilodalton antigens in other mycobacteria." Booth R.J., Williams D.L., Moudgil K.D., Noonan L.C., Grandison P.M., McKee J.J., Prestidge R.L., Watson J.D. Infect. Immun. 61:1509-1515 (1993)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD106 / VCAM1 (1.4C3), CF647 conjugate, 0.1mg/mL
BNC470149-500 1x 500 µL

CD106 / VCAM1 (1.4C3), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, LMW (AE-1), CF405S conjugate, 0.1mg/mL
BNC040253-100 1x 100 µL

Cytokeratin, LMW (AE-1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD6 (3F7B5), CF405S conjugate, 0.1mg/mL
BNC040428-100 1x 100 µL

CD6 (3F7B5), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD31 / PECAM-1 (C31.7), CF594 conjugate, 0.1mg/mL
BNC940014-100 1x 100 µL

CD31 / PECAM-1 (C31.7), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC18 / CD146 / MCAM (Melanoma Cell Adhesion Molecule) (rMUC18/1130), CF568 conjugate, 0.1mg/mL
BNC682302-100 1x 100 µL

MUC18 / CD146 / MCAM (Melanoma Cell Adhesion Molecule) (rMUC18/1130), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Napsin A (Lung Adenocarcinoma Marker) (rNAPSA/1239), CF488A conjugate, 0.1mg/mL
BNC881880-500 1x 500 µL

Napsin A (Lung Adenocarcinoma Marker) (rNAPSA/1239), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details