Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Staphylococcal complement inhibitor (scn)

Product Specifications

Product Name Alternative

(SCIN)

Abbreviation

Recombinant Staphylococcus aureus scn protein

Gene Name

Scn

UniProt

A7X482

Expression Region

32-116aa

Organism

Staphylococcus aureus (strain Mu3 / ATCC 700698)

Target Sequence

STSLPTSNEYQNEKLANELKSLLDELNVNELATGSLNTYYKRTIKISGQKAMYALKSKDFKKMSEAKYQLQKIYNEIDEALKSKY

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

Involved in countering the first line of host defense mechanisms. Efficiently inhibits opsonization, phagocytosis and killing of S.aureus by human neutrophils. Acts by binding and stabilizing human C3 convertases (C4b2a and C3bBb), leading to their inactivation. The convertases are no longer able to cleave complement C3, therefore preventing further C3b deposition on the bacterial surface and phagocytosis of the bacterium. Also prevents C5a-induced neutrophil responses.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

17.2 kDa

References & Citations

"Mutated response regulator graR is responsible for phenotypic conversion of Staphylococcus aureus from heterogeneous vancomycin-intermediate resistance to vancomycin-intermediate resistance." Neoh H.-M., Cui L., Yuzawa H., Takeuchi F., Matsuo M., Hiramatsu K. Antimicrob. Agents Chemother. 52:45-53 (2008) .

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Apolipoprotein L ELISA Kit (APOL1)
RK02614 96 Tests

Mouse Apolipoprotein L ELISA Kit (APOL1)

Sign In for Pricing
View Details
Recombinant Human F-actin-capping protein subunit alpha-2 (CAPZA2)
MBS966042-01 0.02 mg (Yeast)

Recombinant Human F-actin-capping protein subunit alpha-2 (CAPZA2)

Sign In for Pricing
View Details
Recombinant Human F-actin-capping protein subunit alpha-2 (CAPZA2)
MBS966042-02 0.1 mg (Yeast)

Recombinant Human F-actin-capping protein subunit alpha-2 (CAPZA2)

Sign In for Pricing
View Details
Recombinant Human F-actin-capping protein subunit alpha-2 (CAPZA2)
MBS966042-03 1 mg (Yeast)

Recombinant Human F-actin-capping protein subunit alpha-2 (CAPZA2)

Sign In for Pricing
View Details
Recombinant Human F-actin-capping protein subunit alpha-2 (CAPZA2)
MBS966042-04 5x 1 mg (Yeast)

Recombinant Human F-actin-capping protein subunit alpha-2 (CAPZA2)

Sign In for Pricing
View Details
Malonyl-HIST1H3A (K56) Antibody
A25057-100UL 100 µL

Malonyl-HIST1H3A (K56) Antibody

Sign In for Pricing
View Details