Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free IL-15, Human (His)

IL-15 protein regulates immune cells, stimulates the proliferation of NK cells, T cells, and B cells, and promotes cytokine secretion. Animal-Free IL-15 Protein, Human (His) is the recombinant human-derived animal-FreeIL-15 protein, expressed by E. coli , with N-His, N-His labeled tag.This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free IL-15 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-il-15-protein-human-his.html

Purity

98.0

Smiles

NWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTSLE

Molecular Formula

3600 (Gene_ID) P40933-1 (N49-S162) (Accession)

Molecular Weight

Approximately 13 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

pExpress-1-Rbm48 Plasmid
PVT39252 2 µg

pExpress-1-Rbm48 Plasmid

Sign In for Pricing
View Details
COX4 (COX4I1) Human qPCR Primer Pair (NM_001861)
HP205639 200 Reactions

COX4 (COX4I1) Human qPCR Primer Pair (NM_001861)

Sign In for Pricing
View Details
Acetyl-α-Tubulin (Lys40) Rabbit mAb
C05305-01 20 µL

Acetyl-α-Tubulin (Lys40) Rabbit mAb

Sign In for Pricing
View Details
Acetyl-α-Tubulin (Lys40) Rabbit mAb
C05305-02 100 µL

Acetyl-α-Tubulin (Lys40) Rabbit mAb

Sign In for Pricing
View Details
Acetyl-α-Tubulin (Lys40) Rabbit mAb
C05305-03 2x 100 μL

Acetyl-α-Tubulin (Lys40) Rabbit mAb

Sign In for Pricing
View Details
Human TNNI2 (Troponin I Type 2, Fast Skeletal) Microsample ELISA Kit
orb2998469-01 48 Tests

Human TNNI2 (Troponin I Type 2, Fast Skeletal) Microsample ELISA Kit

Sign In for Pricing
View Details