Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Pulmonary surfactant-associated protein C (Sftpc)

Product Specifications

Product Name Alternative

Pulmonary surfactant-associated proteolipid SPL (Val) (SP5) (SP-C) (Sftp2)

Abbreviation

Recombinant Mouse Sftpc protein

Gene Name

Sftpc

UniProt

P21841

Expression Region

24-58aa

Organism

Mus musculus (Mouse)

Target Sequence

FRIPCCPVHLKRLLIVVVVVVLVVVVIVGALLMGL

Tag

N-terminal 6xHis-KSI-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Cancer

Relevance

Pulmonary surfactant associated proteins promote alveolar stability by lowering the surface tension at the air-liquid interface in the peripheral air spaces.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

19.1 kDa

References & Citations

"Expression of a human surfactant protein C mutation associated with interstitial lung disease disrupts lung development in transgenic mice." Bridges J.P., Wert S.E., Nogee L.M., Weaver T.E. J. Biol. Chem. 278:52739-52746 (2003)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Clec2m Mouse Gene Knockout Kit (CRISPR)
KN500349 1 Kit

Clec2m Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Cd5l Mouse Gene Knockout Kit (CRISPR)
KN502930 1 Kit

Cd5l Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Nectin2 Mouse Gene Knockout Kit (CRISPR)
KN514268 1 Kit

Nectin2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human Activator of basal transcription 1 (ABT1) activation kit by CRISPRa
GA109266 1 Kit

Human Activator of basal transcription 1 (ABT1) activation kit by CRISPRa

Sign In for Pricing
View Details
Alyref2 Rabbit Polyclonal Antibody
TA363501 100 µL

Alyref2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PAK1 pThr212 Rabbit Polyclonal Antibody
AP02438PU-N 100 µL

PAK1 pThr212 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details