Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PTPRZ1, Human (P.pastoris, His)

The PTPRZ1 protein is an important tyrosine phosphatase that negatively regulates oligodendrocyte precursor proliferation in the embryonic spinal cord. It plays a crucial role in guiding the normal differentiation of precursor cells into mature oligodendrocytes and may act as an anti-apoptotic factor. PTPRZ1 Protein, Human (P.pastoris, His) is the recombinant human-derived PTPRZ1 protein, expressed by P. pastoris , with N-His labeled tag.

Product Specifications

Product Name Alternative

PTPRZ1 Protein, Human (P.pastoris, His), Human, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ptprz1-protein-human-p-pastoris-his.html

Purity

90.00

Smiles

IGWSYTGALNQKNWGKKYPTCNSPKQSPINIDEDLTQVNVNLKKLKFQGWDKTSLENTFIHNTGKTVEINLTNDYRVSGGVSEMVFKASKITFHWGKCNMSSDGSEHSLEGQKFPLEMQIYCFDADRFSSFEEAVKGKGKLRALSILFEVGTEENLDFKAIIDGVESVSRFGKQAALDPFILLNLLPNSTDKYYIYNGSLTSPPCTDTVDWIVFKDTVSISESQLAVFCEVLTMQQSGYVMLMDYLQNNFREQQYKFSRQVFSSY

Molecular Formula

5803 (Gene_ID) P23471-1 (I36-Y300) (Accession)

Molecular Weight

Approximately 35 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD16 Antibody
orb1326185 100 µg

CD16 Antibody

Sign In for Pricing
View Details
ZFAND2B Rabbit Polyclonal Antibody (Biotin)
orb2087350 100 µL

ZFAND2B Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
Mouse Monoclonal Siglec-5/CD170 Antibody (07) [DyLight 350]
NBP3-06442UV 0.1 mL

Mouse Monoclonal Siglec-5/CD170 Antibody (07) [DyLight 350]

Sign In for Pricing
View Details
SEPTIN14 Rabbit Polyclonal Antibody
TA316377 100 µL

SEPTIN14 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant human FUBP1 protein
ATGP1587-100 100 µg

Recombinant human FUBP1 protein

Sign In for Pricing
View Details
Myc Antibody
OAAF00641-100UG 100 µg

Myc Antibody

Sign In for Pricing
View Details