Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NKp30/NCR3, Rat (HEK293, His)

NKp30/NCR3 protein is a cell membrane receptor on natural killer (NK) cells that activates cytotoxicity by binding to ligands such as BAG6 and NCR3LG1, stimulating NK cells to respond against neighboring cells (including tumor cells) expressing these ligands. NKp30/NCR3 Protein, Rat (HEK293, His) is the recombinant rat-derived NKp30/NCR3 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

NKp30/NCR3 Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/nkp30-ncr3-protein-rat-hek293-his.html

Purity

95.10

Smiles

IWVSQPPEIRAQEGTTASLPCSFNASRGKAAIGSATWYQDKVAPGMELSNVTPGFRGRVASFSASQFIRGHKAGLLIQDIQSHDARIYVCRVEVLGLGVGTGNGTRLVVEKEPPQQASNAEPERAAYTS

Molecular Formula

294251 (Gene_ID) Q8CFD9 (I19-S147) (Accession)

Molecular Weight

Approximately 25-33 kDa.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SEC24C Polyclonal Antibody
orb615436-01 50 μL

SEC24C Polyclonal Antibody

Sign In for Pricing
View Details
SEC24C Polyclonal Antibody
orb615436-02 100 µL

SEC24C Polyclonal Antibody

Sign In for Pricing
View Details
Vamp1 Peptide - N-terminal region
orb2005581 100 µg

Vamp1 Peptide - N-terminal region

Sign In for Pricing
View Details
EPO Receptor/EPOR Protein (C-hFc, Human)
P514988 100 µg

EPO Receptor/EPOR Protein (C-hFc, Human)

Sign In for Pricing
View Details
N (4) - (β-N-acetylglucosaminyl) -L-asparaginase (AGA) Mouse ELISA Kit
F2152 96 Tests

N (4) - (β-N-acetylglucosaminyl) -L-asparaginase (AGA) Mouse ELISA Kit

Sign In for Pricing
View Details
ITPR2 (Inositol 1,4,5-trisphosphate Receptor Type 2, IP3 Receptor Isoform 2, IP3R 2, InsP3R2, Type 2 Inositol 1,4,5-trisphosphate Receptor, Type 2 InsP3 Receptor)
I8472-03B 100 µg

ITPR2 (Inositol 1,4,5-trisphosphate Receptor Type 2, IP3 Receptor Isoform 2, IP3R 2, InsP3R2, Type 2 Inositol 1,4,5-trisphosphate Receptor, Type 2 InsP3 Receptor)

Sign In for Pricing
View Details