Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRMT112, Human (His-SUMO)

TRMT112 protein activates various methyltransferases for rRNA, tRNA, and protein modifications. It cooperates with BUD23 to methylate guanine N (7) of 18S rRNA. TRMT112 Protein, Human (His-SUMO) is the recombinant human-derived TRMT112 protein, expressed by E. coli , with N-His, N-SUMO labeled tag.

Product Specifications

Product Name Alternative

TRMT112 Protein, Human (His-SUMO), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/trmt112-protein-human-his-sumo.html

Purity

92.0

Smiles

MKLLTHNLLSSHVRGVGSRGFPLRLQATEVRICPVEFNPNFVARMIPKVEWSAFLEAADNLRLIQVPKGPVEGYEENEEFLRTMHHLLLEVEVIEGTLQCPESGRMFPISRGIPNMLLSEEETES

Molecular Formula

51504 (Gene_ID) Q9UI30-1 (M1-S125) (Accession)

Molecular Weight

Approximately 32 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal DCBLD2/ESDN Antibody [Allophycocyanin]
NB100-93567APC 0.1 mL

Rabbit Polyclonal DCBLD2/ESDN Antibody [Allophycocyanin]

Sign In for Pricing
View Details
Rat BEN domain-containing protein 3 (BEND3) ELISA Kit
MBS7250667-01 48 Well

Rat BEN domain-containing protein 3 (BEND3) ELISA Kit

Sign In for Pricing
View Details
Rat BEN domain-containing protein 3 (BEND3) ELISA Kit
MBS7250667-02 96 Well

Rat BEN domain-containing protein 3 (BEND3) ELISA Kit

Sign In for Pricing
View Details
Rat BEN domain-containing protein 3 (BEND3) ELISA Kit
MBS7250667-03 5x 96 Well

Rat BEN domain-containing protein 3 (BEND3) ELISA Kit

Sign In for Pricing
View Details
Rat BEN domain-containing protein 3 (BEND3) ELISA Kit
MBS7250667-04 10x 96 Well

Rat BEN domain-containing protein 3 (BEND3) ELISA Kit

Sign In for Pricing
View Details
1,7-Dibromo-2,6-heptanedione
TRC-D357520-500MG 500 mg

1,7-Dibromo-2,6-heptanedione

Sign In for Pricing
View Details