Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRMT112, Human (His-SUMO)

TRMT112 protein activates various methyltransferases for rRNA, tRNA, and protein modifications. It cooperates with BUD23 to methylate guanine N (7) of 18S rRNA. TRMT112 Protein, Human (His-SUMO) is the recombinant human-derived TRMT112 protein, expressed by E. coli , with N-His, N-SUMO labeled tag.

Product Specifications

Product Name Alternative

TRMT112 Protein, Human (His-SUMO), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/trmt112-protein-human-his-sumo.html

Purity

92.0

Smiles

MKLLTHNLLSSHVRGVGSRGFPLRLQATEVRICPVEFNPNFVARMIPKVEWSAFLEAADNLRLIQVPKGPVEGYEENEEFLRTMHHLLLEVEVIEGTLQCPESGRMFPISRGIPNMLLSEEETES

Molecular Formula

51504 (Gene_ID) Q9UI30-1 (M1-S125) (Accession)

Molecular Weight

Approximately 32 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Titin (TTN, Connectin, Rhabdomyosarcoma Antigen MU-RMS-40.14) (MaxLight 490)
MBS6203910-01 0.1 mL

Titin (TTN, Connectin, Rhabdomyosarcoma Antigen MU-RMS-40.14) (MaxLight 490)

Sign In for Pricing
View Details
Titin (TTN, Connectin, Rhabdomyosarcoma Antigen MU-RMS-40.14) (MaxLight 490)
MBS6203910-02 5x 0.1 mL

Titin (TTN, Connectin, Rhabdomyosarcoma Antigen MU-RMS-40.14) (MaxLight 490)

Sign In for Pricing
View Details
EDC3 siRNA (Mouse)
MBS8215142-01 15 nmol

EDC3 siRNA (Mouse)

Sign In for Pricing
View Details
EDC3 siRNA (Mouse)
MBS8215142-02 30 nmol

EDC3 siRNA (Mouse)

Sign In for Pricing
View Details
EDC3 siRNA (Mouse)
MBS8215142-03 5x 30 nmol

EDC3 siRNA (Mouse)

Sign In for Pricing
View Details
Sari 59-801
MF-0019121-01 1 mg

Sari 59-801

Sign In for Pricing
View Details