Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRMT112, Human (His-SUMO)

TRMT112 protein activates various methyltransferases for rRNA, tRNA, and protein modifications. It cooperates with BUD23 to methylate guanine N (7) of 18S rRNA. TRMT112 Protein, Human (His-SUMO) is the recombinant human-derived TRMT112 protein, expressed by E. coli , with N-His, N-SUMO labeled tag.

Product Specifications

Product Name Alternative

TRMT112 Protein, Human (His-SUMO), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/trmt112-protein-human-his-sumo.html

Purity

92.0

Smiles

MKLLTHNLLSSHVRGVGSRGFPLRLQATEVRICPVEFNPNFVARMIPKVEWSAFLEAADNLRLIQVPKGPVEGYEENEEFLRTMHHLLLEVEVIEGTLQCPESGRMFPISRGIPNMLLSEEETES

Molecular Formula

51504 (Gene_ID) Q9UI30-1 (M1-S125) (Accession)

Molecular Weight

Approximately 32 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tygon Tube 3350, 12.70 x 3.20 mm, PU=15 m
1209957 15 m

Tygon Tube 3350, 12.70 x 3.20 mm, PU=15 m

Sign In for Pricing
View Details
Recombinant Salmonella fdhE Protein (aa 1-309)
VAng-Wyb1073-1mgEcoli 1 mg (E. coli)

Recombinant Salmonella fdhE Protein (aa 1-309)

Sign In for Pricing
View Details
SDAD1 (NM_018115) Human Tagged ORF Clone Lentiviral Particle
RC212822L4V 200 µL

SDAD1 (NM_018115) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Lentiviral mouse Uba2 shRNA (UAS) - Lentiviral mouse Uba2 shRNA (UAS, GFP) (100)
GTR15276321 1 Vial

Lentiviral mouse Uba2 shRNA (UAS) - Lentiviral mouse Uba2 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
HIV-1 p24 (Human Immunodeficiency Virus-1) (APC)
MBS6268842-01 0.1 mL

HIV-1 p24 (Human Immunodeficiency Virus-1) (APC)

Sign In for Pricing
View Details
HIV-1 p24 (Human Immunodeficiency Virus-1) (APC)
MBS6268842-02 5x 0.1 mL

HIV-1 p24 (Human Immunodeficiency Virus-1) (APC)

Sign In for Pricing
View Details