Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Prolactin, Human

Prolactin Protein acts on the mammary gland, promoting lactation through its interaction with the receptor PRLR. Prolactin Protein, Human is the recombinant human-derived Prolactin protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

Prolactin Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/prolactin-protein-human.html

Purity

98.0

Smiles

LPICPGGAARCQVTLRDLFDRAVVLSHYIHNLSSEMFSEFDKRYTHGRGFITKAINSCHTSSLATPEDKEQAQQMNQKDFLSLIVSILRSWNEPLYHLVTEVRGMQEAPEAILSKAVEIEEQTKRLLEGMELIVSQVHPETKENEIYPVWSGLPSLQMADEESRLSAYYNLLHCLRRDSHKIDNYLKLLKCRIIHNNNC

Molecular Formula

5617 (Gene_ID) P01236 (L29-C227) (Accession)

Molecular Weight

Approximately 25 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

rac 4-Hydroxy-9-cis-retinoic Acid
TRC-H953310-1MG 1 mg

rac 4-Hydroxy-9-cis-retinoic Acid

Sign In for Pricing
View Details
Scramblase 1 Rabbit Polyclonal Antibody
HA500063 100 µL

Scramblase 1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SULt2a5 Mouse Gene Knockout Kit (CRISPR)
KN516970 1 Kit

SULt2a5 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Frozen Tissue Sections, Stomach
CS502792 5x 5 µm

Frozen Tissue Sections, Stomach

Sign In for Pricing
View Details
Elopiprazole
TRC-E115460-100MG 100 mg

Elopiprazole

Sign In for Pricing
View Details
Chk1 (CHEK1) Rabbit Polyclonal Antibody
AP02645PU-N 100 µL

Chk1 (CHEK1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details