Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Prolactin, Human

Prolactin Protein acts on the mammary gland, promoting lactation through its interaction with the receptor PRLR. Prolactin Protein, Human is the recombinant human-derived Prolactin protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

Prolactin Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/prolactin-protein-human.html

Purity

98.0

Smiles

LPICPGGAARCQVTLRDLFDRAVVLSHYIHNLSSEMFSEFDKRYTHGRGFITKAINSCHTSSLATPEDKEQAQQMNQKDFLSLIVSILRSWNEPLYHLVTEVRGMQEAPEAILSKAVEIEEQTKRLLEGMELIVSQVHPETKENEIYPVWSGLPSLQMADEESRLSAYYNLLHCLRRDSHKIDNYLKLLKCRIIHNNNC

Molecular Formula

5617 (Gene_ID) P01236 (L29-C227) (Accession)

Molecular Weight

Approximately 25 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

7-Chloro-1-ethyl-6-fluoro-1,4-dihydro-4-oxo-3-quinolinecarboxylic Acid Ethyl-d5 Ester
TRC-C315512-50MG 50 mg

7-Chloro-1-ethyl-6-fluoro-1,4-dihydro-4-oxo-3-quinolinecarboxylic Acid Ethyl-d5 Ester

Sign In for Pricing
View Details
RHEB Human Gene Knockout Kit (CRISPR)
KN400307 1 Kit

RHEB Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
B3GNT5 Human Gene Knockout Kit (CRISPR)
KN206965BN 1 Kit

B3GNT5 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
DL-Threonic Acid Calcium
TRC-T405588-1MG 1 mg

DL-Threonic Acid Calcium

Sign In for Pricing
View Details
N-Ethyl-m-toluamide
TRC-E923100-1G 1 g

N-Ethyl-m-toluamide

Sign In for Pricing
View Details
Sumo 2 (SUMO2) (NM_001005849) Human Over-expression Lysate
LY423659 100 µg

Sumo 2 (SUMO2) (NM_001005849) Human Over-expression Lysate

Sign In for Pricing
View Details