Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Prolactin, Human

Prolactin Protein acts on the mammary gland, promoting lactation through its interaction with the receptor PRLR. Prolactin Protein, Human is the recombinant human-derived Prolactin protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

Prolactin Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/prolactin-protein-human.html

Purity

98.0

Smiles

LPICPGGAARCQVTLRDLFDRAVVLSHYIHNLSSEMFSEFDKRYTHGRGFITKAINSCHTSSLATPEDKEQAQQMNQKDFLSLIVSILRSWNEPLYHLVTEVRGMQEAPEAILSKAVEIEEQTKRLLEGMELIVSQVHPETKENEIYPVWSGLPSLQMADEESRLSAYYNLLHCLRRDSHKIDNYLKLLKCRIIHNNNC

Molecular Formula

5617 (Gene_ID) P01236 (L29-C227) (Accession)

Molecular Weight

Approximately 25 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

4,5-Dibromo-1,2,6,7-tertahydro-8H-indeno[5,4-b]furan-8-one
TRC-D425478-50MG 50 mg

4,5-Dibromo-1,2,6,7-tertahydro-8H-indeno[5,4-b]furan-8-one

Sign In for Pricing
View Details
OR5P3 (NM_153445) Human Over-expression Lysate
LC403511 20 µg

OR5P3 (NM_153445) Human Over-expression Lysate

Sign In for Pricing
View Details
Human CLPTM1L activation kit by CRISPRa
GA113018 1 Kit

Human CLPTM1L activation kit by CRISPRa

Sign In for Pricing
View Details
ALS2CR13 (FAM117B) (NM_173511) Human Over-expression Lysate
LY432314 100 µg

ALS2CR13 (FAM117B) (NM_173511) Human Over-expression Lysate

Sign In for Pricing
View Details
ACSM1 Human Gene Knockout Kit (CRISPR)
KN420646 1 Kit

ACSM1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
P21 / WAF1 (DCS-60.2), CF568 conjugate, 0.1mg/mL
BNC680822-500 1x 500 µL

P21 / WAF1 (DCS-60.2), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details