Apolipoprotein A-I/APOA1, Human

Apolipoprotein A-I/APOA1 Protein is a secreted protein located on the outside of cell membranes and is the main structural apolipoprotein of high-density lipoprotein (HDL), playing a key role in the reverse cholesterol transport pathway. Apolipoprotein A-I/APOA1 protein interacts with the cell surface receptor SR-BI, thereby promoting dengue virus (DV) infection. Apolipoprotein A-I/APOA1 Protein can also activate sperm motility as part of the SPAP complex. Apolipoprotein A-I/APOA1 Protein has anti-inflammatory, anti-atherosclerotic, anti-apoptotic, anti-tumor, and anti-thrombotic functions. Apolipoprotein A-I/APOA1 Protein Protein, Human is made up of 267 amino acids and is expressed in Escherichia coli (E. coli) [1][2][3][4].

Product Specifications

Product Name Alternative

Apolipoprotein A-I/APOA1 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/apolipoprotein-a-i-protein-human.html

Purity

98.0

Smiles

RHFWQQDEPPQSPWDRVKDLATVYVDVLKDSGRDYVSQFEGSALGKQLNLKLLDNWDSVTSTFSKLREQLGPVTQEFWDNLEKETEGLRQEMSKDLEEVKAKVQPYLDDFQKKWQEEMELYRQKVEPLRAELQEGARQKLHELQEKLSPLGEEMRDRARAHVDALRTHLAPYSDELRQRLAARLEALKENGGARLAEYHAKATEHLSTLSEKAKPALEDLRQGLLPVLESFKVSFLSALEEYTKKLNTQ

Molecular Formula

335 (Gene_ID) P02647 (R19-Q267) (Accession)

Molecular Weight

Approximately 25-27 kDa

References & Citations

[1]Obici L, et al. Structure, function and amyloidogenic propensity of apolipoprotein A-I. Amyloid. 2006 Dec;13 (4) :191-205. |[2]Akerlöf E, et al. Identification of apolipoprotein A1 and immunoglobulin as components of a serum complex that mediates activation of human sperm motility. Biochemistry. 1991 Sep 17;30 (37) :8986-90. |[3]Bhale AS, et al. Leveraging knowledge of HDLs major protein ApoA1: Structure, function, mutations, and potential therapeutics. Biomed Pharmacother. 2022 Oct;154:113634.|[4]Li Y, et al. Human apolipoprotein A-I is associated with dengue virus and enhances virus infection through SR-BI. PLoS One. 2013 Jul 24;8 (7) :e70390. |[5]Plump AS, et al. Human apolipoprotein A-I gene expression increases high density lipoprotein and suppresses atherosclerosis in the apolipoprotein E-deficient mouse. Proc Natl Acad Sci U S A. 1994 Sep 27;91 (20) :9607-11. |[6]Su F, et al. Apolipoprotein A-I (apoA-I) and apoA-I mimetic peptides inhibit tumor development in a mouse model of ovarian cancer. Proc Natl Acad Sci U S A. 2010 Nov 16;107 (46) :19997-20002.