Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ECM1, Rat (HEK293, His)

The ECM1 protein is a multifaceted player that negatively regulates bone mineralization and affects endochondral bone formation. In addition to bone biology, it stimulates endothelial cell proliferation and angiogenesis and exerts regulatory control on MMP9 proteolytic activity. ECM1 Protein, Rat (HEK293, His) is the recombinant rat-derived ECM1 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

ECM1 Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ecm1-protein-rat-hek293-his.html

Purity

97.0

Smiles

ASEGAFKVSDQREMKPEHLFQHLHEVGYAAPPSPPQTRRLQVHHSETSPHDPPLFEEQKEVQPPSSPEDIPVYEEEWLTFLNPNVGKVDPALPQEAIPLQKEQPPPRIPIEQKEIDPPVQHQEEIVQSRQKEEKPPTLTGQHPPEPRTWNPARHCQQGRRGIWGHRLDGFPPGRPSPDNLKQICLPERQHVVYGPWNLPQTGYSHLSRQGEALNLLETGYSRCCRCRSDTNRLDCVKLVWEDAMTQFCEAEFSVKTRPHLCCKQRGEERFSCFQKEAPRPDYLLRPCPIHQTGISSGTQLPFPPGLPTPDNVKNICLLRRFRSVPRNLPATDAIQRQLQALTRLETEFQRCCRQGHNHTCTWKAWEDTLDGYCDRELAIKTHPHSCCHYPPSPARDECFAHLAPYPNYDRDLLTVDLSRVTPNLMDHLCGNGRVLSKHKQIPGLIQNMTVRCCELPYPEQACCGEEEKLAFIEDLCGPRRNSWKDPALCCTLSPGDKQANCFNTNYLRNVALVAGDTGNATGLGQQGPTGGTNVGPAPGSKEE

Molecular Formula

116662 (Gene_ID) Q62894/NP_446334.1 (A20-E562) (Accession)

Molecular Weight

Approximately 75-80 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tyk2-IN-7 1mg
A21491-1 1 mg

Tyk2-IN-7 1mg

Sign In for Pricing
View Details
MAP7 Antibody
A28116-100UL 100 µL

MAP7 Antibody

Sign In for Pricing
View Details
Rat Thimet Oligopeptidase (THOP1) ELISA Kit
SL2121Ra-01 48 Tests

Rat Thimet Oligopeptidase (THOP1) ELISA Kit

Sign In for Pricing
View Details
Rat Thimet Oligopeptidase (THOP1) ELISA Kit
SL2121Ra-02 96 Tests

Rat Thimet Oligopeptidase (THOP1) ELISA Kit

Sign In for Pricing
View Details
Arl13b sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)
K6384907 1.0 µg DNA

Arl13b sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
Monkey C-Peptide (C-P) ELISA Kit
CK-bio-18253-01 48 Tests

Monkey C-Peptide (C-P) ELISA Kit

Sign In for Pricing
View Details