Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ECM1, Rat (HEK293, His)

The ECM1 protein is a multifaceted player that negatively regulates bone mineralization and affects endochondral bone formation. In addition to bone biology, it stimulates endothelial cell proliferation and angiogenesis and exerts regulatory control on MMP9 proteolytic activity. ECM1 Protein, Rat (HEK293, His) is the recombinant rat-derived ECM1 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

ECM1 Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ecm1-protein-rat-hek293-his.html

Purity

97.0

Smiles

ASEGAFKVSDQREMKPEHLFQHLHEVGYAAPPSPPQTRRLQVHHSETSPHDPPLFEEQKEVQPPSSPEDIPVYEEEWLTFLNPNVGKVDPALPQEAIPLQKEQPPPRIPIEQKEIDPPVQHQEEIVQSRQKEEKPPTLTGQHPPEPRTWNPARHCQQGRRGIWGHRLDGFPPGRPSPDNLKQICLPERQHVVYGPWNLPQTGYSHLSRQGEALNLLETGYSRCCRCRSDTNRLDCVKLVWEDAMTQFCEAEFSVKTRPHLCCKQRGEERFSCFQKEAPRPDYLLRPCPIHQTGISSGTQLPFPPGLPTPDNVKNICLLRRFRSVPRNLPATDAIQRQLQALTRLETEFQRCCRQGHNHTCTWKAWEDTLDGYCDRELAIKTHPHSCCHYPPSPARDECFAHLAPYPNYDRDLLTVDLSRVTPNLMDHLCGNGRVLSKHKQIPGLIQNMTVRCCELPYPEQACCGEEEKLAFIEDLCGPRRNSWKDPALCCTLSPGDKQANCFNTNYLRNVALVAGDTGNATGLGQQGPTGGTNVGPAPGSKEE

Molecular Formula

116662 (Gene_ID) Q62894/NP_446334.1 (A20-E562) (Accession)

Molecular Weight

Approximately 75-80 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

TERT, ID (Telomerase Reverse Transcriptase, Telomerase Catalytic Subunit, HEST2, Telomerase-associated Protein 2, TP2, EST2, TCS1, TRT) (APC) discontinued
T2399-25B-APC 200 µL

TERT, ID (Telomerase Reverse Transcriptase, Telomerase Catalytic Subunit, HEST2, Telomerase-associated Protein 2, TP2, EST2, TCS1, TRT) (APC) discontinued

Sign In for Pricing
View Details
TP73, ID (p53-related Protein, p53-like Transcription Factor, Tumor Protein p73, P73) (MaxLight 490) discontinued
P1001-39A-ML490 100 µL

TP73, ID (p53-related Protein, p53-like Transcription Factor, Tumor Protein p73, P73) (MaxLight 490) discontinued

Sign In for Pricing
View Details
TMEM127 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)
46882154 3x 1.0 µg DNA

TMEM127 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)

Sign In for Pricing
View Details
Recombinant Schizosaccharomyces pombe Uncharacterized protein C4D7.10c (SPAC4D7.10c)
MBS1047111-01 0.02 mg (E-Coli)

Recombinant Schizosaccharomyces pombe Uncharacterized protein C4D7.10c (SPAC4D7.10c)

Sign In for Pricing
View Details
Recombinant Schizosaccharomyces pombe Uncharacterized protein C4D7.10c (SPAC4D7.10c)
MBS1047111-02 0.02 mg (Yeast)

Recombinant Schizosaccharomyces pombe Uncharacterized protein C4D7.10c (SPAC4D7.10c)

Sign In for Pricing
View Details
Recombinant Schizosaccharomyces pombe Uncharacterized protein C4D7.10c (SPAC4D7.10c)
MBS1047111-03 0.1 mg (E-Coli)

Recombinant Schizosaccharomyces pombe Uncharacterized protein C4D7.10c (SPAC4D7.10c)

Sign In for Pricing
View Details