Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ECM1, Rat (HEK293, His)

The ECM1 protein is a multifaceted player that negatively regulates bone mineralization and affects endochondral bone formation. In addition to bone biology, it stimulates endothelial cell proliferation and angiogenesis and exerts regulatory control on MMP9 proteolytic activity. ECM1 Protein, Rat (HEK293, His) is the recombinant rat-derived ECM1 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

ECM1 Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ecm1-protein-rat-hek293-his.html

Purity

97.0

Smiles

ASEGAFKVSDQREMKPEHLFQHLHEVGYAAPPSPPQTRRLQVHHSETSPHDPPLFEEQKEVQPPSSPEDIPVYEEEWLTFLNPNVGKVDPALPQEAIPLQKEQPPPRIPIEQKEIDPPVQHQEEIVQSRQKEEKPPTLTGQHPPEPRTWNPARHCQQGRRGIWGHRLDGFPPGRPSPDNLKQICLPERQHVVYGPWNLPQTGYSHLSRQGEALNLLETGYSRCCRCRSDTNRLDCVKLVWEDAMTQFCEAEFSVKTRPHLCCKQRGEERFSCFQKEAPRPDYLLRPCPIHQTGISSGTQLPFPPGLPTPDNVKNICLLRRFRSVPRNLPATDAIQRQLQALTRLETEFQRCCRQGHNHTCTWKAWEDTLDGYCDRELAIKTHPHSCCHYPPSPARDECFAHLAPYPNYDRDLLTVDLSRVTPNLMDHLCGNGRVLSKHKQIPGLIQNMTVRCCELPYPEQACCGEEEKLAFIEDLCGPRRNSWKDPALCCTLSPGDKQANCFNTNYLRNVALVAGDTGNATGLGQQGPTGGTNVGPAPGSKEE

Molecular Formula

116662 (Gene_ID) Q62894/NP_446334.1 (A20-E562) (Accession)

Molecular Weight

Approximately 75-80 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

BMVC-8C3O 100mg
A22052-100 100 mg

BMVC-8C3O 100mg

Sign In for Pricing
View Details
Mouse Monoclonal MAGEA3 Antibody (OTI1G9) [FITC]
NBP2-72570F 0.1 mL

Mouse Monoclonal MAGEA3 Antibody (OTI1G9) [FITC]

Sign In for Pricing
View Details
ACRV1 Recombinant Antibody, AbBy Fluor™ 555 Conjugated
bsm-62041R-BF555 100 µL

ACRV1 Recombinant Antibody, AbBy Fluor™ 555 Conjugated

Sign In for Pricing
View Details
Lentiviral human PSME3 shRNA (UAS) - Lentiviral human PSME3 shRNA (UAS, GFP) (25)
GTR15159404 1 Vial

Lentiviral human PSME3 shRNA (UAS) - Lentiviral human PSME3 shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
HSP90B2P Polyclonal Antibody
NHP-AB379 Each

HSP90B2P Polyclonal Antibody

Sign In for Pricing
View Details
Ccr1l1 Rat shRNA Plasmid (Locus ID 301088)
TL705445 1 Kit

Ccr1l1 Rat shRNA Plasmid (Locus ID 301088)

Sign In for Pricing
View Details