Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ECM1, Rat (HEK293, His)

The ECM1 protein is a multifaceted player that negatively regulates bone mineralization and affects endochondral bone formation. In addition to bone biology, it stimulates endothelial cell proliferation and angiogenesis and exerts regulatory control on MMP9 proteolytic activity. ECM1 Protein, Rat (HEK293, His) is the recombinant rat-derived ECM1 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

ECM1 Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ecm1-protein-rat-hek293-his.html

Purity

97.0

Smiles

ASEGAFKVSDQREMKPEHLFQHLHEVGYAAPPSPPQTRRLQVHHSETSPHDPPLFEEQKEVQPPSSPEDIPVYEEEWLTFLNPNVGKVDPALPQEAIPLQKEQPPPRIPIEQKEIDPPVQHQEEIVQSRQKEEKPPTLTGQHPPEPRTWNPARHCQQGRRGIWGHRLDGFPPGRPSPDNLKQICLPERQHVVYGPWNLPQTGYSHLSRQGEALNLLETGYSRCCRCRSDTNRLDCVKLVWEDAMTQFCEAEFSVKTRPHLCCKQRGEERFSCFQKEAPRPDYLLRPCPIHQTGISSGTQLPFPPGLPTPDNVKNICLLRRFRSVPRNLPATDAIQRQLQALTRLETEFQRCCRQGHNHTCTWKAWEDTLDGYCDRELAIKTHPHSCCHYPPSPARDECFAHLAPYPNYDRDLLTVDLSRVTPNLMDHLCGNGRVLSKHKQIPGLIQNMTVRCCELPYPEQACCGEEEKLAFIEDLCGPRRNSWKDPALCCTLSPGDKQANCFNTNYLRNVALVAGDTGNATGLGQQGPTGGTNVGPAPGSKEE

Molecular Formula

116662 (Gene_ID) Q62894/NP_446334.1 (A20-E562) (Accession)

Molecular Weight

Approximately 75-80 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

RCAN1 (Regulator of Calcineurin 1, Calcipressin 1, CSP1, DSC1, RCN1, DSCR1, MCIP1, ADAPT78) discontinued
213047-01 20 µL

RCAN1 (Regulator of Calcineurin 1, Calcipressin 1, CSP1, DSC1, RCN1, DSCR1, MCIP1, ADAPT78) discontinued

Sign In for Pricing
View Details
RCAN1 (Regulator of Calcineurin 1, Calcipressin 1, CSP1, DSC1, RCN1, DSCR1, MCIP1, ADAPT78) discontinued
213047-02 100 µL

RCAN1 (Regulator of Calcineurin 1, Calcipressin 1, CSP1, DSC1, RCN1, DSCR1, MCIP1, ADAPT78) discontinued

Sign In for Pricing
View Details
Recombinant Human IL23R Protein, C-hFc (Active)
AHJ03701 100 μg

Recombinant Human IL23R Protein, C-hFc (Active)

Sign In for Pricing
View Details
ICA1 Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)
LV685349 1.0 µg DNA

ICA1 Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details
Human Myosin Light Chain 1, Alkali, Fast Skeletal (MYL1) ELISA Kit
QY-E03038 96 Tests

Human Myosin Light Chain 1, Alkali, Fast Skeletal (MYL1) ELISA Kit

Sign In for Pricing
View Details
Rabbit Polyclonal ENPP4 Antibody
NBP3-05178-20ul 20 µL

Rabbit Polyclonal ENPP4 Antibody

Sign In for Pricing
View Details