Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ECM1, Rat (HEK293, His)

The ECM1 protein is a multifaceted player that negatively regulates bone mineralization and affects endochondral bone formation. In addition to bone biology, it stimulates endothelial cell proliferation and angiogenesis and exerts regulatory control on MMP9 proteolytic activity. ECM1 Protein, Rat (HEK293, His) is the recombinant rat-derived ECM1 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

ECM1 Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ecm1-protein-rat-hek293-his.html

Purity

97.0

Smiles

ASEGAFKVSDQREMKPEHLFQHLHEVGYAAPPSPPQTRRLQVHHSETSPHDPPLFEEQKEVQPPSSPEDIPVYEEEWLTFLNPNVGKVDPALPQEAIPLQKEQPPPRIPIEQKEIDPPVQHQEEIVQSRQKEEKPPTLTGQHPPEPRTWNPARHCQQGRRGIWGHRLDGFPPGRPSPDNLKQICLPERQHVVYGPWNLPQTGYSHLSRQGEALNLLETGYSRCCRCRSDTNRLDCVKLVWEDAMTQFCEAEFSVKTRPHLCCKQRGEERFSCFQKEAPRPDYLLRPCPIHQTGISSGTQLPFPPGLPTPDNVKNICLLRRFRSVPRNLPATDAIQRQLQALTRLETEFQRCCRQGHNHTCTWKAWEDTLDGYCDRELAIKTHPHSCCHYPPSPARDECFAHLAPYPNYDRDLLTVDLSRVTPNLMDHLCGNGRVLSKHKQIPGLIQNMTVRCCELPYPEQACCGEEEKLAFIEDLCGPRRNSWKDPALCCTLSPGDKQANCFNTNYLRNVALVAGDTGNATGLGQQGPTGGTNVGPAPGSKEE

Molecular Formula

116662 (Gene_ID) Q62894/NP_446334.1 (A20-E562) (Accession)

Molecular Weight

Approximately 75-80 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rubella virus
1712 100 ug

Rubella virus

Sign In for Pricing
View Details
Vom1r102 3'UTR Luciferase Stable Cell Line
TU223060 1.0 mL

Vom1r102 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Human CX3CR1 (Chemokine C-X3-C-Motif Receptor 1) ELISA Kit
ELK4545-01 48 Tests

Human CX3CR1 (Chemokine C-X3-C-Motif Receptor 1) ELISA Kit

Sign In for Pricing
View Details
Human CX3CR1 (Chemokine C-X3-C-Motif Receptor 1) ELISA Kit
ELK4545-02 96 Tests

Human CX3CR1 (Chemokine C-X3-C-Motif Receptor 1) ELISA Kit

Sign In for Pricing
View Details
Human CX3CR1 (Chemokine C-X3-C-Motif Receptor 1) ELISA Kit
ELK4545-03 5x 96 Tests

Human CX3CR1 (Chemokine C-X3-C-Motif Receptor 1) ELISA Kit

Sign In for Pricing
View Details
PDAP1 Human shRNA Plasmid Kit (Locus ID 11333)
TR319004 1 Kit

PDAP1 Human shRNA Plasmid Kit (Locus ID 11333)

Sign In for Pricing
View Details