Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ECM1, Rat (HEK293, His)

The ECM1 protein is a multifaceted player that negatively regulates bone mineralization and affects endochondral bone formation. In addition to bone biology, it stimulates endothelial cell proliferation and angiogenesis and exerts regulatory control on MMP9 proteolytic activity. ECM1 Protein, Rat (HEK293, His) is the recombinant rat-derived ECM1 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

ECM1 Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ecm1-protein-rat-hek293-his.html

Purity

97.0

Smiles

ASEGAFKVSDQREMKPEHLFQHLHEVGYAAPPSPPQTRRLQVHHSETSPHDPPLFEEQKEVQPPSSPEDIPVYEEEWLTFLNPNVGKVDPALPQEAIPLQKEQPPPRIPIEQKEIDPPVQHQEEIVQSRQKEEKPPTLTGQHPPEPRTWNPARHCQQGRRGIWGHRLDGFPPGRPSPDNLKQICLPERQHVVYGPWNLPQTGYSHLSRQGEALNLLETGYSRCCRCRSDTNRLDCVKLVWEDAMTQFCEAEFSVKTRPHLCCKQRGEERFSCFQKEAPRPDYLLRPCPIHQTGISSGTQLPFPPGLPTPDNVKNICLLRRFRSVPRNLPATDAIQRQLQALTRLETEFQRCCRQGHNHTCTWKAWEDTLDGYCDRELAIKTHPHSCCHYPPSPARDECFAHLAPYPNYDRDLLTVDLSRVTPNLMDHLCGNGRVLSKHKQIPGLIQNMTVRCCELPYPEQACCGEEEKLAFIEDLCGPRRNSWKDPALCCTLSPGDKQANCFNTNYLRNVALVAGDTGNATGLGQQGPTGGTNVGPAPGSKEE

Molecular Formula

116662 (Gene_ID) Q62894/NP_446334.1 (A20-E562) (Accession)

Molecular Weight

Approximately 75-80 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Ar (Amphiregulin) ELISA Kit
FY-EM1847 96 Well

Mouse Ar (Amphiregulin) ELISA Kit

Sign In for Pricing
View Details
Armenian Hamster IgG Isotype Control (PIP), PerCP-Cy5.5-100ug
QAB69-PCP55-100ug 100ug

Armenian Hamster IgG Isotype Control (PIP), PerCP-Cy5.5-100ug

Sign In for Pricing
View Details
Rabbit Anti-EIF3α/EIF3J Polyclonal Antibody
PAV6894 100 μL

Rabbit Anti-EIF3α/EIF3J Polyclonal Antibody

Sign In for Pricing
View Details
1810030O07Rik Mouse siRNA Oligo Duplex (Locus ID 69155)
SR410598 1 Kit

1810030O07Rik Mouse siRNA Oligo Duplex (Locus ID 69155)

Sign In for Pricing
View Details
DYRK2, NT (Dual-specificity Tyrosine-phosphorylation Regulated Kinase 2) (MaxLight 750)
MBS6473318-01 0.1 mL

DYRK2, NT (Dual-specificity Tyrosine-phosphorylation Regulated Kinase 2) (MaxLight 750)

Sign In for Pricing
View Details
DYRK2, NT (Dual-specificity Tyrosine-phosphorylation Regulated Kinase 2) (MaxLight 750)
MBS6473318-02 5x 0.1 mL

DYRK2, NT (Dual-specificity Tyrosine-phosphorylation Regulated Kinase 2) (MaxLight 750)

Sign In for Pricing
View Details