Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ECM1, Rat (HEK293, His)

The ECM1 protein is a multifaceted player that negatively regulates bone mineralization and affects endochondral bone formation. In addition to bone biology, it stimulates endothelial cell proliferation and angiogenesis and exerts regulatory control on MMP9 proteolytic activity. ECM1 Protein, Rat (HEK293, His) is the recombinant rat-derived ECM1 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

ECM1 Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ecm1-protein-rat-hek293-his.html

Purity

97.0

Smiles

ASEGAFKVSDQREMKPEHLFQHLHEVGYAAPPSPPQTRRLQVHHSETSPHDPPLFEEQKEVQPPSSPEDIPVYEEEWLTFLNPNVGKVDPALPQEAIPLQKEQPPPRIPIEQKEIDPPVQHQEEIVQSRQKEEKPPTLTGQHPPEPRTWNPARHCQQGRRGIWGHRLDGFPPGRPSPDNLKQICLPERQHVVYGPWNLPQTGYSHLSRQGEALNLLETGYSRCCRCRSDTNRLDCVKLVWEDAMTQFCEAEFSVKTRPHLCCKQRGEERFSCFQKEAPRPDYLLRPCPIHQTGISSGTQLPFPPGLPTPDNVKNICLLRRFRSVPRNLPATDAIQRQLQALTRLETEFQRCCRQGHNHTCTWKAWEDTLDGYCDRELAIKTHPHSCCHYPPSPARDECFAHLAPYPNYDRDLLTVDLSRVTPNLMDHLCGNGRVLSKHKQIPGLIQNMTVRCCELPYPEQACCGEEEKLAFIEDLCGPRRNSWKDPALCCTLSPGDKQANCFNTNYLRNVALVAGDTGNATGLGQQGPTGGTNVGPAPGSKEE

Molecular Formula

116662 (Gene_ID) Q62894/NP_446334.1 (A20-E562) (Accession)

Molecular Weight

Approximately 75-80 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

WWTR1 sgRNA CRISPR Lentivector (Human) (Target 1)
K0005502 1.0 µg DNA

WWTR1 sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
pBluescriptR-SLC35F1 Plasmid
PVT23448 2 µg

pBluescriptR-SLC35F1 Plasmid

Sign In for Pricing
View Details
CACNG7 (Voltage-dependent Calcium Channel gamma-7 Subunit, Neuronal Voltage-gated Calcium Channel gamma-7 Subunit, Transmembrane AMPAR Regulatory Protein gamma-7) (MaxLight 550)
124225-ML550 100 µL

CACNG7 (Voltage-dependent Calcium Channel gamma-7 Subunit, Neuronal Voltage-gated Calcium Channel gamma-7 Subunit, Transmembrane AMPAR Regulatory Protein gamma-7) (MaxLight 550)

Sign In for Pricing
View Details
RPLP1P7 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)
LV781486 1.0 µg DNA

RPLP1P7 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details
Colloidal Gold Conjugated Monoclonal Antibody to Free Kappa Light Chain,  5nm
GM-100-5 1 mL

Colloidal Gold Conjugated Monoclonal Antibody to Free Kappa Light Chain, 5nm

Sign In for Pricing
View Details
RBBP7 (RbAp46) (4D7) Mouse Monoclonal antibody
E28PE1748 100 µL

RBBP7 (RbAp46) (4D7) Mouse Monoclonal antibody

Sign In for Pricing
View Details