Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ECM1, Rat (HEK293, His)

The ECM1 protein is a multifaceted player that negatively regulates bone mineralization and affects endochondral bone formation. In addition to bone biology, it stimulates endothelial cell proliferation and angiogenesis and exerts regulatory control on MMP9 proteolytic activity. ECM1 Protein, Rat (HEK293, His) is the recombinant rat-derived ECM1 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

ECM1 Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ecm1-protein-rat-hek293-his.html

Purity

97.0

Smiles

ASEGAFKVSDQREMKPEHLFQHLHEVGYAAPPSPPQTRRLQVHHSETSPHDPPLFEEQKEVQPPSSPEDIPVYEEEWLTFLNPNVGKVDPALPQEAIPLQKEQPPPRIPIEQKEIDPPVQHQEEIVQSRQKEEKPPTLTGQHPPEPRTWNPARHCQQGRRGIWGHRLDGFPPGRPSPDNLKQICLPERQHVVYGPWNLPQTGYSHLSRQGEALNLLETGYSRCCRCRSDTNRLDCVKLVWEDAMTQFCEAEFSVKTRPHLCCKQRGEERFSCFQKEAPRPDYLLRPCPIHQTGISSGTQLPFPPGLPTPDNVKNICLLRRFRSVPRNLPATDAIQRQLQALTRLETEFQRCCRQGHNHTCTWKAWEDTLDGYCDRELAIKTHPHSCCHYPPSPARDECFAHLAPYPNYDRDLLTVDLSRVTPNLMDHLCGNGRVLSKHKQIPGLIQNMTVRCCELPYPEQACCGEEEKLAFIEDLCGPRRNSWKDPALCCTLSPGDKQANCFNTNYLRNVALVAGDTGNATGLGQQGPTGGTNVGPAPGSKEE

Molecular Formula

116662 (Gene_ID) Q62894/NP_446334.1 (A20-E562) (Accession)

Molecular Weight

Approximately 75-80 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Borrelia Hermsii vsp22 Protein (aa 1-217)
VAng-Lsx2228-1mgEcoli 1 mg (E. coli)

Recombinant Borrelia Hermsii vsp22 Protein (aa 1-217)

Sign In for Pricing
View Details
GSK3 alpha (Phospho-S21) Antibody
E51A00511 100 µL

GSK3 alpha (Phospho-S21) Antibody

Sign In for Pricing
View Details
Low density lipoProtein Receptor adapter Protein 1 (LDLRAP1)
322524-01 50 µL

Low density lipoProtein Receptor adapter Protein 1 (LDLRAP1)

Sign In for Pricing
View Details
Low density lipoProtein Receptor adapter Protein 1 (LDLRAP1)
322524-02 100 µL

Low density lipoProtein Receptor adapter Protein 1 (LDLRAP1)

Sign In for Pricing
View Details
Retnlb (Resistin-like beta, Cysteine-rich Secreted ProteinA12-beta, Cysteine-rich Secreted Protein FIZZ2, RELMbeta, Fizz2, 9030012B21Rik) (HRP)
MBS6403955-01 0.1 mL

Retnlb (Resistin-like beta, Cysteine-rich Secreted ProteinA12-beta, Cysteine-rich Secreted Protein FIZZ2, RELMbeta, Fizz2, 9030012B21Rik) (HRP)

Sign In for Pricing
View Details
Retnlb (Resistin-like beta, Cysteine-rich Secreted ProteinA12-beta, Cysteine-rich Secreted Protein FIZZ2, RELMbeta, Fizz2, 9030012B21Rik) (HRP)
MBS6403955-02 5x 0.1 mL

Retnlb (Resistin-like beta, Cysteine-rich Secreted ProteinA12-beta, Cysteine-rich Secreted Protein FIZZ2, RELMbeta, Fizz2, 9030012B21Rik) (HRP)

Sign In for Pricing
View Details