Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Lymphocyte antigen 6E/LY6E, Human (His-SUMO)

Lymphocyte antigen 6E/LY6E protein is a GPI-anchored cell surface regulator that regulates T cell receptor signaling through interaction with CD3Z/CD247. It limits the entry of human coronaviruses, serves as the primary receptor for syncytin-A, and may modulate nicotinic acetylcholine receptor activity. Lymphocyte antigen 6E/LY6E Protein, Human (His-SUMO) is the recombinant human-derived Lymphocyte antigen 6E/LY6E protein, expressed by E. coli , with N-His, N-SUMO labeled tag.

Product Specifications

CAS Number

9007-83-4

Product Name Alternative

Lymphocyte antigen 6E/LY6E Protein, Human (His-SUMO), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ly6e-protein-human-his-sumo.html

Purity

97

Smiles

LMCFSCLNQKSNLYCLKPTICSDQDNYCVTVSASAGIGNLVTFGHSLSKTCSPACPIPEGVNVGVASMGISCCQSFLCNFS

Molecular Formula

4061 (Gene_ID) Q16553 (L21-S101) (Accession)

Molecular Weight

Approximately a 25 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Asl (NM_133768) Mouse Recombinant Protein
E45M46216M5 20 µg

Asl (NM_133768) Mouse Recombinant Protein

Sign In for Pricing
View Details
VWA2 Blocking peptide
orb1443595 500 µg

VWA2 Blocking peptide

Sign In for Pricing
View Details
SCAF1 Human Gene Knockout Kit (CRISPR)
KN407670 1 Kit

SCAF1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
RPGRIP1L Protein Lysate (Mouse) with C-HA Tag
40724034 100 µg

RPGRIP1L Protein Lysate (Mouse) with C-HA Tag

Sign In for Pricing
View Details
Rabbit Polyclonal Niemann-Pick C1 Antibody [DyLight 755]
NB400-148IR 0.1 mL

Rabbit Polyclonal Niemann-Pick C1 Antibody [DyLight 755]

Sign In for Pricing
View Details
DPP7 Antibody
OACA06926-50UL 50 µL

DPP7 Antibody

Sign In for Pricing
View Details